LXL04_003462 | RubberDandelionOmics

Gene overview

LXL04_003462

Reference: OH-1004 Chr: Chr01 Coordinates: 80056910-80058518 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1455 bp · LXL04_003462|LXL04_003462|OH1004|cDNA

ATGGCCTCGATCAAGCTCAATCTGCCTCTCCATGTCTATCTCCATTACAGACCCATCACCAAGATTTCGACCCCAAATAAACATGGTTGGAGGCATCCAAAAACCGATCGATTGTTTCCGGTGATATCCACGACATCAACCACTTCTAAACCGATAGAAACGACGAGTTCAATACGTGAAAAACAGAGCGAGATAAAGGATCAAAACAACTGGCCCAGCCTTTTAAAGCCGATGGATCCGCTTTTACGGTCTGAGCTAAT...

CDS

Download CDS FASTA

1455 bp · LXL04_003462|LXL04_003462|OH1004|CDS

ATGGCCTCGATCAAGCTCAATCTGCCTCTCCATGTCTATCTCCATTACAGACCCATCACCAAGATTTCGACCCCAAATAAACATGGTTGGAGGCATCCAAAAACCGATCGATTGTTTCCGGTGATATCCACGACATCAACCACTTCTAAACCGATAGAAACGACGAGTTCAATACGTGAAAAACAGAGCGAGATAAAGGATCAAAACAACTGGCCCAGCCTTTTAAAGCCGATGGATCCGCTTTTACGGTCTGAGCTAAT...

Protein

Download Protein FASTA

484 aa · LXL04_003462|LXL04_003462|OH1004|PROTEIN

MASIKLNLPLHVYLHYRPITKISTPNKHGWRHPKTDRLFPVISTTSTTSKPIETTSSIREKQSEIKDQNNWPSLLKPMDPLLRSELIRYGEMAQACYDSFDNNPYSKYCGSCKVPPKTFFQDLEMMDLGYDITSYIYSSNTSNLIPNFFTKSIHPDGPWSPMVNWIGYVAISNDKTTARLGKRDITIAWRGTVTKLEWMEDLMNFLKPVSAQKLASRDPNIKVMAGFLHIYTDKDQSCPYSKFSAREQVLAELTRLTNIY...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_003462`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_003462

Location Chr01:80056910-80058518 (+)

Description Similar to At1g06800: Phospholipase A1-Igamma1, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g06800`	Acylhydrolase with a broad specificity.	DONGLE and DEFECTIVE IN ANTHER DEHISCENCE1 lipases are not essential for wound- and pathogen-induced jasmonate biosynthesis: redundant lipases contribute to jasmonate formation.2010 · DOI: 10.1104/pp.110.155093
`At2g30550`	Acylhydrolase with broad specificity.	No verified direct reference in this release
`At1g51440`	Acylhydrolase that catalyzes the hydrolysis of phosphatidylcholine at the sn-1 position.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os01g0900400`	Phospholipase that releases free fatty acids from phospholipids.	No verified direct reference in this release
`UniProt: A2WY00`	Phospholipase that releases free fatty acids from phospholipids.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_003462 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0010582 floral meristem determinacy Biological Process

GO:0016042 lipid catabolic process Biological Process

GO:0048449 floral organ formation Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0004620 glycerophospholipase activity Molecular Function

GO:0004806 triacylglycerol lipase activity Molecular Function

GO:0008970 glycerophospholipid phospholipase A1 activity Molecular Function

GO:0047714 galactolipase activity Molecular Function

KEGG gene cross-reference

ath:AT1G06800

ath:AT1G51440

ath:AT2G30550

dosa:Os01g0900400

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.968

Rank 1 · LXL04_003462 · OH-1004

Cytoplasm0.045

Rank 2 · LXL04_003462 · OH-1004

Mitochondrion0.040

Rank 3 · LXL04_003462 · OH-1004

Peroxisome0.035

Rank 4 · LXL04_003462 · OH-1004

Nucleus0.021

Rank 5 · LXL04_003462 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01764.32Lipase_3187-346 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_003462	`PF01764.32`	Lipase_3	187	346	3.8e-33	115.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q941F1`	Arabidopsis thaliana	Phospholipase A1-Igamma1, chloroplastic	54.157%	Swiss-Prot	strong database homology
`Q3EBR6`	Arabidopsis thaliana	Phospholipase A1-Igamma2, chloroplastic	52.752%	Swiss-Prot	strong database homology
`Q9C8J6`	Arabidopsis thaliana	Phospholipase A1-Igamma3, chloroplastic	52.294%	Swiss-Prot	strong database homology
`Q8S1D9`	Oryza sativa subsp. japonica	Phospholipase A1 EG1, chloroplastic/mitochondrial	40.845%	Swiss-Prot	moderate database homology
`A2WY00`	Oryza sativa subsp. indica	Phospholipase A1 EG1, chloroplastic/mitochondrial	40.845%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card