TkA01G330540 | RubberDandelionOmics

Gene overview

TkA01G330540

Reference: TK1151 Chr: Chr01 Coordinates: 82120727-82123142 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1271 bp · TkA01G330540|TK1151|cDNA

AGGCTGAAAACTTAAACGCACGTCGTCGTTTGGTCTCTTCTTCGTCGTTGCCCTAACCTAATCAGTCGACGTTCTGCACATCCTTAGGAGCACCTCGACCTTCGCAGAAAACCAGCTCCCGAGTTGCTTCGTTAAAACTAATCCTCACCAGAGCATATCCAGATTTCTTCACTGCTCGGCATTCTCTTCCGGGACCAGTAACCTGCACTGCTCGAAGCCCTCGACTTACCGGACGAGATCGGCTTCACTTGCGTCAATTT...

CDS

Download CDS FASTA

531 bp · TkA01G330540|TK1151|CDS

ATGTGTTTCGTTCAAAGCTCTTCCAGCACCTCCACCATCGCTAGCCATTCAACATCTTCGGGCTTCTCCAACATCTTTCCACACTCGAGCAGAAGCAAGAAGATAAGGTTGAGCCATAAGCTACACGTTGAGTATGGTGGAATAAAAAGCGTTCCAAATCAGCCTAACAAAAGTTCCTCACAAAATAAAGCTGCACCTTCAAGCTCAAATGCTCTTGTGCTATCAGGAACCGAGACTTCCAAAAAGGGTGATTTAACAAC...

Protein

Download Protein FASTA

176 aa · TkA01G330540|TK1151|PROTEIN

MCFVQSSSSTSTIASHSTSSGFSNIFPHSSRSKKIRLSHKLHVEYGGIKSVPNQPNKSSSQNKAAPSSSNALVLSGTETSKKGDLTTTISAQPKNLGDGTTIGKSITIIPSQGTLERNLSTTALMERIPSRWPRPTWHAPWKNYRVISGHLGWVRSIAFDPSNQWFCTGLLIEQSR

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G330540`
TK1151 ID	TkA01G330540
OH-1004 ID	LXL04_009706
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	80.500
Protein coverage (%)	TK1151 75.568 / OH-1004 47.257 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G330540

Location Chr01:82120727-82123142 (-)

Description Similar to PRL1: Protein pleiotropic regulatory locus 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g15900`	Pleiotropic regulator of glucose, stress and hormone responses.	Regulatory interaction of PRL1 WD protein with Arabidopsis SNF1-like protein kinases.1999 · DOI: 10.1073/pnas.96.9.5322 SKP1-SnRK protein kinase interactions mediate proteasomal binding of a plant SCF ubiquitin ligase.2001 · DOI: 10.1093/emboj/20.11.2742 Regulation of plant innate immunity by three proteins in a complex conserved across the plant and animal kingdoms.2007 · DOI: 10.1101/gad.1559607 Signaling from an altered cell wall to the nucleus mediates sugar-responsive growth and development in Arabidopsis thaliana.2007 · DOI: 10.1105/tpc.106.049965 Characterization of Arabidopsis and rice DWD proteins and their roles as substrate receptors for CUL4-RING E3 ubiquitin ligases.2008 · DOI: 10.1105/tpc.107.055418 Modulation of O-mediated retrograde signaling by the PLEIOTROPIC RESPONSE LOCUS 1 (PRL1) protein, a central integrator of stress and energy signaling.2009 · DOI: 10.1111/j.1365-313x.2009.03935.x Pleiotropic regulatory locus 1 (PRL1) integrates the regulation of sugar responses with isoprenoid metabolism in Arabidopsis.2010 · DOI: 10.1093/mp/ssp100 Pleiotropic control of glucose and hormone responses by PRL1, a nuclear WD protein, in Arabidopsis.1998 · DOI: 10.1101/gad.12.19.3059
`At3g16650`	Pleiotropic regulator.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_009706 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000398 mRNA splicing, via spliceosome Biological Process

GO:0006396 RNA processing Biological Process

GO:0009749 response to glucose Biological Process

GO:0009755 hormone-mediated signaling pathway Biological Process

GO:0010154 fruit development Biological Process

GO:0010182 sugar mediated signaling pathway Biological Process

GO:0010215 cellulose microfibril organization Biological Process

GO:0016567 protein ubiquitination Biological Process

GO:0042742 defense response to bacterium Biological Process

GO:0045087 innate immune response Biological Process

GO:0045292 mRNA cis splicing, via spliceosome Biological Process

GO:0045892 negative regulation of DNA-templated transcription Biological Process

KEGG gene cross-reference

ath:AT3G16650

ath:AT4G15900

cnb:CNBG1700

cne:CNG03060

spo:3361260

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.432

Rank 1 · TkA01G330540 · TK1151

Nucleus0.426

Rank 2 · TkA01G330540 · TK1151

Cell membrane0.075

Rank 3 · TkA01G330540 · TK1151

Mitochondrion0.056

Rank 4 · TkA01G330540 · TK1151

Lysosome / Vacuole0.045

Rank 5 · TkA01G330540 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00400WD4011-16 aa

PF00400WD4064-77 aa

PF00400WD40142-169 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G330540	`PF00400`	WD40	11	16	0.00022	22.4
TkA01G330540	`PF00400`	WD40	64	77	0.00022	22.4
TkA01G330540	`PF00400`	WD40	142	169	0.00022	22.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q42384`	Arabidopsis thaliana	sp\|Q42384\|PRL1_ARATH Protein pleiotropic regulatory locus 1	54.200%	Swiss-Prot	High
`Q39190`	Arabidopsis thaliana	sp\|Q39190\|PRL2_ARATH Protein pleiotropic regulator PRL2	51.400%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card