TkA01G319450 | RubberDandelionOmics

Gene overview

TkA01G319450

Reference: TK1151 Chr: Chr01 Coordinates: 79289912-79290669 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

651 bp · TkA01G319450|TK1151|cDNA

ATGGCCGCCACCTTACCGACGAAGGAGTATCGGGTTTTGGGTCGGAGCTTTAGCTTGAACCCAGGTCCGTTTAACATGAGCTTTGGAGCGTTACACGAGAAGGAGACGAAAGCAGAAGGAATGACTCGAATGAGATTCTTCATGATCTTCTTAATCGCAAGCTTCGTATATTACGTATTTCCCGGTTACCTTTTCCCAATTTTGACTTTCTTCTCGTGGGTATGTTGGACATTTATGCACAGTATCACCGCCCAGCAGAT...

CDS

Download CDS FASTA

651 bp · TkA01G319450|TK1151|CDS

ATGGCCGCCACCTTACCGACGAAGGAGTATCGGGTTTTGGGTCGGAGCTTTAGCTTGAACCCAGGTCCGTTTAACATGAGCTTTGGAGCGTTACACGAGAAGGAGACGAAAGCAGAAGGAATGACTCGAATGAGATTCTTCATGATCTTCTTAATCGCAAGCTTCGTATATTACGTATTTCCCGGTTACCTTTTCCCAATTTTGACTTTCTTCTCGTGGGTATGTTGGACATTTATGCACAGTATCACCGCCCAGCAGAT...

Protein

Download Protein FASTA

216 aa · TkA01G319450|TK1151|PROTEIN

MAATLPTKEYRVLGRSFSLNPGPFNMSFGALHEKETKAEGMTRMRFFMIFLIASFVYYVFPGYLFPILTFFSWVCWTFMHSITAQQIGFARFTATLTHVALFHGGDVWKQSRFAAHNVKLDIHAKLMKTYKQVPQWWYLVLLLGSIALSLVMCFVWKEDVQLPWWGFLFAFFLAWIVTLPIGVIQATTNQQPGYDIIAQFIIGYQSLKNSNWIMLP

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G319450`
TK1151 ID	TkA01G319450
OH-1004 ID	LXL04_034732
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	43.100
Protein coverage (%)	TK1151 94.444 / OH-1004 53.992 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G319450

Location Chr01:79289912-79290669 (-)

Description Similar to OPT3: Oligopeptide transporter 3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g16370`	May be involved in the translocation of tetra- and pentapeptides across the cellular membrane in an energy-dependent manner.	AtOPT3, a member of the oligopeptide transporter family, is essential for embryo development in Arabidopsis.2002 · DOI: 10.1105/tpc.005629 Expression profiles of Arabidopsis thaliana in mineral deficiencies reveal novel transporters involved in metal homeostasis.2003 · DOI: 10.1074/jbc.m309338200
`At4g10770`	Involved in the translocation of tetra- and pentapeptides across the cellular membrane in an energy-dependent manner.	AtOPT6 transports glutathione derivatives and is induced by primisulfuron.2004 · DOI: 10.1104/pp.104.039859
`At4g27730`	Involved in the translocation of tetra- and pentapeptides across the cellular membrane in an energy-dependent manner.	AtOPT6 transports glutathione derivatives and is induced by primisulfuron.2004 · DOI: 10.1104/pp.104.039859
`At5g53510`	May be involved in the translocation of tetra- and pentapeptides across the cellular membrane in an energy-dependent manner.	No verified direct reference in this release
`At5g64410`	Involved in the translocation of tetra- and pentapeptides across the cellular membrane in an energy-dependent manner.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_034732 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0015031 protein transport Biological Process

GO:0030003 intracellular monoatomic cation homeostasis Biological Process

GO:0060586 multicellular organismal-level iron ion homeostasis Biological Process

GO:1990388 xylem-to-phloem iron transport Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0016020 membrane Cellular Component

GO:0035673 oligopeptide transmembrane transporter activity Molecular Function

GO:0046915 transition metal ion transmembrane transporter activity Molecular Function

KEGG gene cross-reference

ath:AT1G09930

ath:AT4G10770

ath:AT4G16370

ath:AT4G26590

ath:AT5G64410

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.483

Rank 1 · TkA01G319450 · TK1151

Cell membrane0.197

Rank 2 · TkA01G319450 · TK1151

Lysosome / Vacuole0.168

Rank 3 · TkA01G319450 · TK1151

Golgi apparatus0.069

Rank 4 · TkA01G319450 · TK1151

Cytoplasm0.066

Rank 5 · TkA01G319450 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03169OPT5-26 aa

PF11785Aft1_OSA15-36 aa

PF03169OPT30-87 aa

PF09685MamF_MmsF38-85 aa

PF13567DUF413149-81 aa

PF03169OPT88-204 aa

PF13567DUF4131135-177 aa

PF09685MamF_MmsF141-200 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G319450	`PF03169`	OPT	5	26	5e-40	138.5
TkA01G319450	`PF11785`	Aft1_OSA	15	36	0.27	12.4
TkA01G319450	`PF03169`	OPT	30	87	5e-40	138.5
TkA01G319450	`PF09685`	MamF_MmsF	38	85	0.0055	17.8
TkA01G319450	`PF13567`	DUF4131	49	81	0.49	10.8
TkA01G319450	`PF03169`	OPT	88	204	5e-40	138.5
TkA01G319450	`PF13567`	DUF4131	135	177	0.49	10.8
TkA01G319450	`PF09685`	MamF_MmsF	141	200	0.0055	17.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O23482`	Arabidopsis thaliana	sp\|O23482\|OPT3_ARATH Oligopeptide transporter 3	37.300%	Swiss-Prot	Medium
`O82485`	Arabidopsis thaliana	sp\|O82485\|OPT7_ARATH Oligopeptide transporter 7	33.000%	Swiss-Prot	Medium
`Q9T095`	Arabidopsis thaliana	sp\|Q9T095\|OPT6_ARATH Oligopeptide transporter 6	33.400%	Swiss-Prot	Medium
`Q9FJD2`	Arabidopsis thaliana	sp\|Q9FJD2\|OPT9_ARATH Oligopeptide transporter 9	49.200%	Swiss-Prot	Medium
`Q9FME8`	Arabidopsis thaliana	sp\|Q9FME8\|OPT4_ARATH Oligopeptide transporter 4	45.300%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card