RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA01G303730
Reference: TK1151 Chr: Chr01 Coordinates: 75506450-75508893 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

1071 bp · TkA01G303730|TK1151|cDNA

AAAAAAGTTCCGATTCAAAAATTTCACGTTTCTTAAACGTCCGTTTTCCTCCGATCTGAAGCCCTTAAATACTACGCTCCCCTCTGCATCTCCTTCGTATAACTCACGGGCTTCGTCGGTGATCGACGGTCCCCATTTCAAACGATCTCCGTCACTACCTGCAATCGCCAGCCGATCGCAGATATCATACCAAGATGGGGCTGTCATTTACCAAGCTTTTTAGCCGCTTGTTTGCCAAGAAAGAGATGCGTATTCTGATG...

CDS

Download CDS FASTA

546 bp · TkA01G303730|TK1151|CDS

ATGGGGCTGTCATTTACCAAGCTTTTTAGCCGCTTGTTTGCCAAGAAAGAGATGCGTATTCTGATGGTAGGTCTCGATGCAGCTGGTAAAACCACAATCTTGTACAAGCTCAAGTTGGGAGAGATTGTCACCACCATTCCCACCATCGGGTTTAATGTGGAGACTGTGGAGTACAAGAACATCAGCTTTACAGTGTGGGATGTTGGAGGTCAGGACAAGATCCGGCCATTGTGGAGGCACTACTTCCAGAACACACAAGG...

Protein

Download Protein FASTA

181 aa · TkA01G303730|TK1151|PROTEIN

MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA01G303730
TK1151 IDTkA01G303730
OH-1004 IDLXL04_025839
Relationship / confidenceNon Reciprocal Best Hit / Complex relationship
Protein identity (%)99.400
Protein coverage (%)TK1151 100.000 / OH-1004 100.000
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA01G303730
LocationChr01:75506450-75508893 (-)
DescriptionSimilar to ARF: ADP-ribosylation factor 2
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At1g23490 GTP-binding protein involved in protein trafficking; may modulate vesicle budding and uncoating within the Golgi apparatus. No verified direct reference in this release
At1g70490 GTP-binding protein involved in protein trafficking; may modulate vesicle budding and uncoating within the Golgi apparatus. No verified direct reference in this release
At2g47170 GTP-binding protein involved in protein trafficking.
BEX1/ARF1A1C is required for BFA-sensitive recycling of PIN auxin transporters and auxin-mediated development in Arabidopsis.2014 · DOI: 10.1093/pcp/pct196

Rice

Reference gene IDPossible functionPapers / DOI
Os05g0489600 GTP-binding protein involved in protein trafficking; may modulate vesicle budding and uncoating within the Golgi apparatus. No verified direct reference in this release
Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_025839 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0006886 intracellular protein transport Biological Process
GO:0015031 protein transport Biological Process
GO:0016192 vesicle-mediated transport Biological Process
GO:0000325 plant-type vacuole Cellular Component
GO:0005634 nucleus Cellular Component
GO:0005737 cytoplasm Cellular Component
GO:0005739 mitochondrion Cellular Component
GO:0005794 Golgi apparatus Cellular Component
GO:0005886 plasma membrane Cellular Component
GO:0003729 mRNA binding Molecular Function
GO:0003924 GTPase activity Molecular Function
GO:0003925 G protein activity Molecular Function
KEGG gene cross-reference
ath:AT1G23490
ath:AT1G70490
dosa:Os01g0813400
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Golgi apparatus0.487
Rank 1 · TkA01G303730 · TK1151
Cytoplasm0.381
Rank 2 · TkA01G303730 · TK1151
Endoplasmic reticulum0.193
Rank 3 · TkA01G303730 · TK1151
Cell membrane0.152
Rank 4 · TkA01G303730 · TK1151
Lysosome / Vacuole0.139
Rank 5 · TkA01G303730 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00025Arf5-177 aa
PF015916PF2K13-55 aa
PF00503G-alpha14-39 aa
PF09439SRPRB16-143 aa
PF08477Roc19-129 aa
PF00071Ras19-173 aa
PF04670Gtr1_RagA19-141 aa
PF01926MMR_HSR119-122 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA01G303730PF00025Arf51771.2e-81273.0
TkA01G303730PF015916PF2K13550.008816.1
TkA01G303730PF00503G-alpha14392.3e-1350.7
TkA01G303730PF09439SRPRB161434.5e-1349.7
TkA01G303730PF08477Roc191297.1e-1452.8
TkA01G303730PF00071Ras191735.3e-1246.3
TkA01G303730PF04670Gtr1_RagA191411.6e-0938.3
TkA01G303730PF01926MMR_HSR1191226.6e-0523.7
TkA01G303730PF00009GTP_EFTU20370.02614.9
TkA01G303730PF19993DO-GTPase222370.07413.4
TkA01G303730PF00503G-alpha451112.3e-1350.7
TkA01G303730PF00009GTP_EFTU481440.02614.9
TkA01G303730PF18885DUF5648481020.212.6
TkA01G303730PF015916PF2K801270.008816.1
TkA01G303730PF21875CAPN13-like_C_EFh801260.2712.0
TkA01G303730PF19993DO-GTPase2821510.07413.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q9LQC8Arabidopsis thalianasp|Q9LQC8|ARF2A_ARATH ADP-ribosylation factor 2-A98.900%Swiss-ProtHigh
P0DH91Arabidopsis thalianasp|P0DH91|ARF2B_ARATH ADP-ribosylation factor 2-B98.900%Swiss-ProtHigh
P36397Arabidopsis thalianasp|P36397|ARF1_ARATH ADP-ribosylation factor 198.900%Swiss-ProtHigh
P51823Oryza sativa subsp. japonicasp|P51823|ARF2_ORYSJ ADP-ribosylation factor 298.900%Swiss-ProtHigh

JBrowse

View in Genome Browser