TkA01G270140 | RubberDandelionOmics

Gene overview

TkA01G270140

Reference: TK1151 Chr: Chr01 Coordinates: 67690128-67690801 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

426 bp · TkA01G270140|TK1151|cDNA

ATGAAGTCATCAAGGTTAACGATGACCTCACCCCTGAACATCATCAATTCTTCTGTATCAACTCCTTCGCGCTTTAAAATATATACATACAGTTCATCACATCGCGATCTGAAACCCAAGAACATTCTCGCAAATGCAAATTGCAAATTAAAGATTTGTGATTTTGGTTTAGCGCGTGCTTCATTTGATGATACCCCGTGTCAGCGATTTTTTGGACTGACTACGTGGCCACTAGATGGTATCGCGCTACTGAACTTTGC...

CDS

Download CDS FASTA

426 bp · TkA01G270140|TK1151|CDS

ATGAAGTCATCAAGGTTAACGATGACCTCACCCCTGAACATCATCAATTCTTCTGTATCAACTCCTTCGCGCTTTAAAATATATACATACAGTTCATCACATCGCGATCTGAAACCCAAGAACATTCTCGCAAATGCAAATTGCAAATTAAAGATTTGTGATTTTGGTTTAGCGCGTGCTTCATTTGATGATACCCCGTGTCAGCGATTTTTTGGACTGACTACGTGGCCACTAGATGGTATCGCGCTACTGAACTTTGC...

Protein

Download Protein FASTA

141 aa · TkA01G270140|TK1151|PROTEIN

MKSSRLTMTSPLNIINSSVSTPSRFKIYTYSSSHRDLKPKNILANANCKLKICDFGLARASFDDTPCQRFFGLTTWPLDGIALLNFAVHFFSKYTSAIDIWSIGCIFAEMLTGSHCFLEEMLCTNWILLLICLVLLPRNNC

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G270140`
TK1151 ID	TkA01G270140
OH-1004 ID	LXL04_014939
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	60.600
Protein coverage (%)	TK1151 64.539 / OH-1004 18.672 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G270140

Location Chr01:67690128-67690801 (-)

Description Similar to MPK9: Mitogen-activated protein kinase 9

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g19010`	Mitogen-activated protein kinase 16.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os05g0582400`	Mitogen-activated protein kinase 9.	No verified direct reference in this release
`Os01g0629900`	Mitogen-activated protein kinase 10.	No verified direct reference in this release
`Os11g0271100`	Mitogen-activated protein kinase 15.	No verified direct reference in this release
`Os01g0643800`	Mitogen-activated protein kinase 16.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_014939 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000302 response to reactive oxygen species Biological Process

GO:0007165 signal transduction Biological Process

GO:0009611 response to wounding Biological Process

GO:0009738 abscisic acid-activated signaling pathway Biological Process

GO:0009753 response to jasmonic acid Biological Process

GO:0035556 intracellular signal transduction Biological Process

GO:0042542 response to hydrogen peroxide Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005829 cytosol Cellular Component

GO:0004674 protein serine/threonine kinase activity Molecular Function

KEGG gene cross-reference

ath:AT1G18150

ath:AT1G73670

ath:AT3G18040

dosa:Os05g0576800

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.410

Rank 1 · TkA01G270140 · TK1151

Nucleus0.368

Rank 2 · TkA01G270140 · TK1151

Mitochondrion0.178

Rank 3 · TkA01G270140 · TK1151

Endoplasmic reticulum0.093

Rank 4 · TkA01G270140 · TK1151

Cell membrane0.065

Rank 5 · TkA01G270140 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03109ABC123-60 aa

PF00069Pkinase31-118 aa

PF12330Haspin_kinase31-61 aa

PF07714PK_Tyr_Ser-Thr34-117 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G270140	`PF03109`	ABC1	23	60	0.048	13.5
TkA01G270140	`PF00069`	Pkinase	31	118	5.3e-18	66.1
TkA01G270140	`PF12330`	Haspin_kinase	31	61	0.0012	18.7
TkA01G270140	`PF07714`	PK_Tyr_Ser-Thr	34	117	3.9e-10	40.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8W4J2`	Arabidopsis thaliana	sp\|Q8W4J2\|MPK16_ARATH Mitogen-activated protein kinase 16	60.600%	Swiss-Prot	Medium
`Q6L5D4`	Oryza sativa subsp. japonica	sp\|Q6L5D4\|MPK9_ORYSJ Mitogen-activated protein kinase 9	61.700%	Swiss-Prot	Medium
`Q5ZCI1`	Oryza sativa subsp. japonica	sp\|Q5ZCI1\|MPK10_ORYSJ Mitogen-activated protein kinase 10	60.600%	Swiss-Prot	Medium
`Q53N72`	Oryza sativa subsp. japonica	sp\|Q53N72\|MPK15_ORYSJ Mitogen-activated protein kinase 15	60.600%	Swiss-Prot	Medium
`Q5VP69`	Oryza sativa subsp. japonica	sp\|Q5VP69\|MPK16_ORYSJ Mitogen-activated protein kinase 16	60.600%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card