TkA01G255420 | RubberDandelionOmics

Gene overview

TkA01G255420

Reference: TK1151 Chr: Chr01 Coordinates: 64411859-64412607 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

324 bp · TkA01G255420|TK1151|cDNA

GTTAAAAAGATATTTAAAAATGTCAATGAACTTCCAGATCCAGAGCTTGATGAAGCCATTTGTGAATCGTTTGATGCTGCACAAAAACCAGTTGAGAATATGGAGGTAAGTTGTACAAAAGTTTACAAATTCAGTCCCTCAACTTCCGGGCTAATGTTAATATTATTCTTTGTGAATCTTTTAGGCCAGCAGACTGCTGGGTGTAAAATGATAGTACTTGCAACTCCTCCTTCTAGTGATGGAAGCATATGCAAGGAAGG...

CDS

Download CDS FASTA

324 bp · TkA01G255420|TK1151|CDS

GTTAAAAAGATATTTAAAAATGTCAATGAACTTCCAGATCCAGAGCTTGATGAAGCCATTTGTGAATCGTTTGATGCTGCACAAAAACCAGTTGAGAATATGGAGGTAAGTTGTACAAAAGTTTACAAATTCAGTCCCTCAACTTCCGGGCTAATGTTAATATTATTCTTTGTGAATCTTTTAGGCCAGCAGACTGCTGGGTGTAAAATGATAGTACTTGCAACTCCTCCTTCTAGTGATGGAAGCATATGCAAGGAAGG...

Protein

Download Protein FASTA

107 aa · TkA01G255420|TK1151|PROTEIN

VKKIFKNVNELPDPELDEAICESFDAAQKPVENMEVSCTKVYKFSPSTSGLMLILFFVNLLGQQTAGCKMIVLATPPSSDGSICKEGFKEECMDKTNSLGMNFLASS

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G255420`
TK1151 ID	TkA01G255420
OH-1004 ID	LXL04_023045
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	61.100
Protein coverage (%)	TK1151 100.000 / OH-1004 64.901 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G255420

Location Chr01:64411859-64412607 (+)

Description Similar to HDH: Histidinol dehydrogenase, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g63890`	Catalyzes the sequential NAD-dependent oxidations of L-histidinol to L-histidinaldehyde and then to L-histidine.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os01g0232700`	Catalyzes the sequential NAD-dependent oxidations of L-histidinol to L-histidinaldehyde and then to L-histidine.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_023045 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000105 L-histidine biosynthetic process Biological Process

GO:0009411 response to UV Biological Process

GO:0009555 pollen development Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009536 plastid Cellular Component

GO:0009570 chloroplast stroma Cellular Component

GO:0004399 histidinol dehydrogenase activity Molecular Function

GO:0004635 phosphoribosyl-AMP cyclohydrolase activity Molecular Function

GO:0004636 phosphoribosyl-ATP diphosphatase activity Molecular Function

GO:0005524 ATP binding Molecular Function

KEGG gene cross-reference

ath:AT5G63890

dosa:Os01g0232700

spo:2539650

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.271

Rank 1 · TkA01G255420 · TK1151

Cell membrane0.217

Rank 2 · TkA01G255420 · TK1151

Nucleus0.206

Rank 3 · TkA01G255420 · TK1151

Mitochondrion0.186

Rank 4 · TkA01G255420 · TK1151

Endoplasmic reticulum0.135

Rank 5 · TkA01G255420 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00815Histidinol_dh1-41 aa

PF00815Histidinol_dh61-85 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G255420	`PF00815`	Histidinol_dh	1	41	0.062	13.1
TkA01G255420	`PF00815`	Histidinol_dh	61	85	0.062	13.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9C5U8`	Arabidopsis thaliana	sp\|Q9C5U8\|HIS8_ARATH Histidinol dehydrogenase, chloroplastic	36.100%	Swiss-Prot	Medium
`Q5NAY4`	Oryza sativa subsp. japonica	sp\|Q5NAY4\|HISX_ORYSJ Histidinol dehydrogenase, chloroplastic	37.100%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card