TkA01G211070 | RubberDandelionOmics

Gene overview

TkA01G211070

Reference: TK1151 Chr: Chr01 Coordinates: 53700106-53700806 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

357 bp · TkA01G211070|TK1151|cDNA

CAATTGCTGACTGCAAAACCTGTTGTTTATTTGGTTAATATGAATGAAAAAGATTATGCGAGAAAAAAGAACAAGTTTCTTCCCAAGATTCATGCTTGGGTGCAAGAGCATGGGGGAGAGACAATTATTCCTTTCAGTTGTTCATTGGAAAGGAATCTTGCTGACCTGGCAGATGATGAAGCAGCAAAATACTGTGAGGAGAACAAGATACAAAGTGCCCTTCCAAAGATTATTAAGACTGGATTTTCTGCTATTAATCT...

CDS

Download CDS FASTA

318 bp · TkA01G211070|TK1151|CDS

ATGAATGAAAAAGATTATGCGAGAAAAAAGAACAAGTTTCTTCCCAAGATTCATGCTTGGGTGCAAGAGCATGGGGGAGAGACAATTATTCCTTTCAGTTGTTCATTGGAAAGGAATCTTGCTGACCTGGCAGATGATGAAGCAGCAAAATACTGTGAGGAGAACAAGATACAAAGTGCCCTTCCAAAGATTATTAAGACTGGATTTTCTGCTATTAATCTTATATACTTCTTCACTGCTGGACCTGATGAGGTTAAATG...

Protein

Download Protein FASTA

106 aa · TkA01G211070|TK1151|PROTEIN

MNEKDYARKKNKFLPKIHAWVQEHGGETIIPFSCSLERNLADLADDEAAKYCEENKIQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRQTKAPQAAGEIHTD

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G211070`
TK1151 ID	TkA01G211070
OH-1004 ID	LXL04_004025
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	97.200
Protein coverage (%)	TK1151 100.000 / OH-1004 60.227 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G211070

Location Chr01:53700106-53700806 (-)

Description Similar to YchF1: Obg-like ATPase 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g30580`	Hydrolyzes ATP, and can also hydrolyze GTP with lower efficiency.	The unconventional P-loop NTPase OsYchF1 and its regulator OsGAP1 play opposite roles in salinity stress tolerance.2013 · DOI: 10.1111/pce.12108

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: B8BBN7`	Hydrolyzes ATP, and can also hydrolyze GTP with lower efficiency.	No verified direct reference in this release
`Os08g0199300`	Hydrolyzes ATP, and can also hydrolyze GTP with lower efficiency.	An ancient P-loop GTPase in rice is regulated by a higher plant-specific regulatory protein.2010 · DOI: 10.1074/jbc.m110.172080 ATP binding by the P-loop NTPase OsYchF1 (an unconventional G protein) contributes to biotic but not abiotic stress responses.2016 · DOI: 10.1073/pnas.1522966113

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_004025 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006952 defense response Biological Process

GO:0009651 response to salt stress Biological Process

GO:0046034 ATP metabolic process Biological Process

GO:1900425 negative regulation of defense response to bacterium Biological Process

GO:1901001 negative regulation of response to salt stress Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005730 nucleolus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009506 plasmodesma Cellular Component

KEGG gene cross-reference

ath:AT1G30580

dosa:Os08g0199300

gga:424144

hsa:29789

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.778

Rank 1 · TkA01G211070 · TK1151

Nucleus0.179

Rank 2 · TkA01G211070 · TK1151

Mitochondrion0.090

Rank 3 · TkA01G211070 · TK1151

Cell membrane0.057

Rank 4 · TkA01G211070 · TK1151

Extracellular0.051

Rank 5 · TkA01G211070 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF06071YchF-GTPase_C74-106 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G211070	`PF06071`	YchF-GTPase_C	74	106	9.9e-13	48.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SA73`	Arabidopsis thaliana	sp\|Q9SA73\|OLA1_ARATH Obg-like ATPase 1	85.800%	Swiss-Prot	High
`B8BBN7`	Oryza sativa subsp. indica	sp\|B8BBN7\|OLA1_ORYSI Obg-like ATPase 1	84.900%	Swiss-Prot	High
`Q6Z1J6`	Oryza sativa subsp. japonica	sp\|Q6Z1J6\|OLA1_ORYSJ Obg-like ATPase 1	84.900%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card