RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

LXL04_004025
Reference: OH-1004 Chr: Chr01 Coordinates: 122460121-122461340 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

632 bp · LXL04_004025|LXL04_004025|OH1004|cDNA

TTGCTCTTTTTCTGTAGGTCAAAGCCTGGCTTGAGAGTGAGAAGGATATCCGGTTAGGTGACTGGAAAGCTGCTGAAATTGAAATCTTCAACACTTTTCAATTGCTGACTGCAAAACCTGTTGTTTATTTGGTTAATATGAATGAAAAAGATTATGCGAGAAAAAAGAACAAGTTTCTTCCCAAGATTCATGCTTGGGTGCAAGAGCATGGAGGAGAGACAATTATTCCTTTCAGTTGTTCATTGGAAAGGAATCTTGCT...

CDS

Download CDS FASTA

531 bp · LXL04_004025|LXL04_004025|OH1004|CDS

TTGCTGACTGCAAAACCTGTTGTTTATTTGGTTAATATGAATGAAAAAGATTATGCGAGAAAAAAGAACAAGTTTCTTCCCAAGATTCATGCTTGGGTGCAAGAGCATGGAGGAGAGACAATTATTCCTTTCAGTTGTTCATTGGAAAGGAATCTTGCTGACCTGGTAGATGATGAAGCAGCAAAATACTGTGAGGAGAACAAGATACAAAGTGCCCTTCCAAAGATTATTAAGACTGGATTTTCTGCTATTAACCTTAT...

Protein

Download Protein FASTA

176 aa · LXL04_004025|LXL04_004025|OH1004|PROTEIN

MLTAKPVVYLVNMNEKDYARKKNKFLPKIHAWVQEHGGETIIPFSCSLERNLADLVDDEAAKYCEENKIQSALPKIIKTGFSAINLIYFFTAGPDEVKCWQIRRPTKAPQAAGAIHTDFERGFICAEVMKFEDLKEHGSESAVKAAGKYKQEGKTYVVQDGDIIFFKFNVSGGGKK

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDLXL04_004025
Source versionOH-1004 / GCA_047496595.1_OSU_TarKok_2.0
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDLXL04_004025
LocationChr01:122460121-122461340 (+)
DescriptionSimilar to YchF1: Obg-like ATPase 1
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At1g30580 Hydrolyzes ATP, and can also hydrolyze GTP with lower efficiency.
The unconventional P-loop NTPase OsYchF1 and its regulator OsGAP1 play opposite roles in salinity stress tolerance.2013 · DOI: 10.1111/pce.12108

Rice

Reference gene IDPossible functionPapers / DOI
Os08g0199300 Hydrolyzes ATP, and can also hydrolyze GTP with lower efficiency.
An ancient P-loop GTPase in rice is regulated by a higher plant-specific regulatory protein.2010 · DOI: 10.1074/jbc.m110.172080
ATP binding by the P-loop NTPase OsYchF1 (an unconventional G protein) contributes to biotic but not abiotic stress responses.2016 · DOI: 10.1073/pnas.1522966113
UniProt: B8BBN7 Hydrolyzes ATP, and can also hydrolyze GTP with lower efficiency. No verified direct reference in this release
Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_004025 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)
GO:0006952 defense response Biological Process
GO:0009651 response to salt stress Biological Process
GO:0046034 ATP metabolic process Biological Process
GO:1900425 negative regulation of defense response to bacterium Biological Process
GO:1901001 negative regulation of response to salt stress Biological Process
GO:0005576 extracellular region Cellular Component
GO:0005634 nucleus Cellular Component
GO:0005730 nucleolus Cellular Component
GO:0005737 cytoplasm Cellular Component
GO:0005829 cytosol Cellular Component
GO:0005886 plasma membrane Cellular Component
GO:0009506 plasmodesma Cellular Component
KEGG gene cross-reference
ath:AT1G30580
dosa:Os08g0199300
gga:424144
hsa:29789
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.856
Rank 1 · LXL04_004025 · OH-1004
Nucleus0.233
Rank 2 · LXL04_004025 · OH-1004
Cell membrane0.065
Rank 3 · LXL04_004025 · OH-1004
Mitochondrion0.064
Rank 4 · LXL04_004025 · OH-1004
Endoplasmic reticulum0.061
Rank 5 · LXL04_004025 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF06071.20YchF-GTPase_C86-169 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
LXL04_004025PF06071.20YchF-GTPase_C861693.4e-39133.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q9SA73Arabidopsis thalianaObg-like ATPase 186.932%Swiss-Protstrong database homology
Q6Z1J6Oryza sativa subsp. japonicaObg-like ATPase 188.068%Swiss-Protstrong database homology
B8BBN7Oryza sativa subsp. indicaObg-like ATPase 187.500%Swiss-Protstrong database homology

JBrowse

View in Genome Browser