RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA01G169220
Reference: TK1151 Chr: Chr01 Coordinates: 43390099-43390488 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

306 bp · TkA01G169220|TK1151|cDNA

ATGGCACTCATGTCTATTCAAAATCGCCGTCCGATTGAATCCGCACTTCCAACTTTGGCTAAACCAATCATGTCATTGGATGCCGATGAAGATGTTGTAATCGGGACCCTCAAACAGAGCTTGGTAATACAGTACATATACATATATATTTATATATGTACTTATATTAAAAGTAAGTGTGTGCATATTAATTTTGATTTCAATTTCTTTTTTCAGAGGCAATTGGAGACATTGGGTGCTCAAAGGGCAAGTCTGGAAGA...

CDS

Download CDS FASTA

306 bp · TkA01G169220|TK1151|CDS

ATGGCACTCATGTCTATTCAAAATCGCCGTCCGATTGAATCCGCACTTCCAACTTTGGCTAAACCAATCATGTCATTGGATGCCGATGAAGATGTTGTAATCGGGACCCTCAAACAGAGCTTGGTAATACAGTACATATACATATATATTTATATATGTACTTATATTAAAAGTAAGTGTGTGCATATTAATTTTGATTTCAATTTCTTTTTTCAGAGGCAATTGGAGACATTGGGTGCTCAAAGGGCAAGTCTGGAAGA...

Protein

Download Protein FASTA

101 aa · TkA01G169220|TK1151|PROTEIN

MALMSIQNRRPIESALPTLAKPIMSLDADEDVVIGTLKQSLVIQYIYIYIYICTYIKSKCVHINFDFNFFFQRQLETLGAQRASLEDMLKDMKRNVCFNSI

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA01G169220
TK1151 IDTkA01G169220
OH-1004 IDLXL04_011317
Relationship / confidenceNon Reciprocal Best Hit / Complex relationship
Protein identity (%)61.700
Protein coverage (%)TK1151 93.069 / OH-1004 7.151
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA01G169220
LocationChr01:43390099-43390488 (-)
DescriptionSimilar to BRO1: Vacuolar-sorting protein BRO1
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At1g15130 Class E VPS protein involved in concentration and sorting of cargo proteins of the multivesicular body (MVB) for incorporation into intralumenal vesicles.
Arabidopsis ALIX is required for the endosomal localization of the deubiquitinating enzyme AMSH3.2015 · DOI: 10.1073/pnas.1510516112
ESCRT-III-Associated Protein ALIX Mediates High-Affinity Phosphate Transporter Trafficking to Maintain Phosphate Homeostasis in Arabidopsis.2015 · DOI: 10.1105/tpc.15.00393

Rice

No hit for this species in the current source table.

Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_011317 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0000281 mitotic cytokinesis Biological Process
GO:0000915 actomyosin contractile ring assembly Biological Process
GO:0007033 vacuole organization Biological Process
GO:0009653 anatomical structure morphogenesis Biological Process
GO:0010824 regulation of centrosome duplication Biological Process
GO:0015031 protein transport Biological Process
GO:0016236 macroautophagy Biological Process
GO:0019722 calcium-mediated signaling Biological Process
GO:0036257 multivesicular body organization Biological Process
GO:0039702 viral budding via host ESCRT complex Biological Process
GO:0042318 penicillin biosynthetic process Biological Process
GO:0043328 protein transport to vacuole involved in ubiquitin-dependent protein catabolic process via the multivesicular body sorting pathway Biological Process
KEGG gene cross-reference
ani:ANIA_04351
ath:AT1G15130
cnb:CNBG4510
ddi:DDB_G0275451
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.423
Rank 1 · TkA01G169220 · TK1151
Nucleus0.346
Rank 2 · TkA01G169220 · TK1151
Mitochondrion0.151
Rank 3 · TkA01G169220 · TK1151
Endoplasmic reticulum0.117
Rank 4 · TkA01G169220 · TK1151
Golgi apparatus0.089
Rank 5 · TkA01G169220 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
F4HXZ1Arabidopsis thalianasp|F4HXZ1|BRO1_ARATH Vacuolar-sorting protein BRO154.800%Swiss-ProtHigh

JBrowse

View in Genome Browser