TkA01G158550 | RubberDandelionOmics

Gene overview

TkA01G158550

Reference: TK1151 Chr: Chr01 Coordinates: 40521174-40523952 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2455 bp · TkA01G158550|TK1151|cDNA

CATCTTCTTTAATTCTTTAATATATTTATCGCTTCGGTTTTCCCCATTTCCTCCCCCGCTTGCCCTCGTCCATACCCACTAGGGTTTCAATAATCCTTCCATTGTGTTACTCTCTTCAAAGATTTTGGAGCTAAATGATACCAGGATTATGAGATTGGAGCTTTTGCGATAATTTCATCGGTTAGGTTAAATATTCGTCGATTCGACAACAGATTCGGATACTTTTGCGATAATTTCATCGGTTAGCTTTTGCGATGATT...

CDS

Download CDS FASTA

1689 bp · TkA01G158550|TK1151|CDS

ATGGATGATCTTATGATTGATACAAACGGACTGGGCGATAACTCAGACATCGAAGGTGATGACATAAGATGTGAAAACATAGCAGAAAAAGACGTAAGCGATGAAGAAATCGAAGCTGAAGAGCTGGAAAGACGGATGTGGAAAGACAGAATCAAACTCAAAAGGATCAAAGAAAAACAAAAGATTCTAGCACAACAAGCTGCAGAAAAGCAAAAAGCAAAGCAAACAAGCGATCAGGCTCGAAGAAAAAAAATGTCAAG...

Protein

Download Protein FASTA

562 aa · TkA01G158550|TK1151|PROTEIN

MDDLMIDTNGLGDNSDIEGDDIRCENIAEKDVSDEEIEAEELERRMWKDRIKLKRIKEKQKILAQQAAEKQKAKQTSDQARRKKMSRAQDGILKYMLKLMEVCKARGFVYGIVPEKGKPVSGSSDNLRAWWKEKVKFDKNGPAAISKYDAECLLKGQGIGSQNGNSNSILQDLQDATLGSLLSSLMQHCDPPQRKFPLEKLQPPPWWPTGGEEWWPKLGLPMGPSPPYKKPHDLKKLWKVGVLTAVIKHMSPNIAKIRRL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G158550`
TK1151 ID	TkA01G158550
OH-1004 ID	LXL04_014220
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	74.100
Protein coverage (%)	TK1151 38.790 / OH-1004 36.304 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G158550

Location Chr01:40521174-40523952 (-)

Description Similar to EIN3: Protein ETHYLENE INSENSITIVE 3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g73730`	Probable transcription factor that may be involved in the ethylene response pathway.	No verified direct reference in this release
`At2g27050`	Probable transcription factor acting as a positive regulator in the ethylene response pathway.	Activation of the ethylene gas response pathway in Arabidopsis by the nuclear protein ETHYLENE-INSENSITIVE3 and related proteins.1997 · DOI: 10.1016/s0092-8674(00)80300-1
`At3g20770`	Transcription factor acting as a positive regulator in the ethylene response pathway, by promoting histone acetylation in an ENAP1-dependent manner, thus accelerating the expression of ethylene- responsive genes.	Biochemical and Structural Insights into the Mechanism of DNA Recognition by Arabidopsis ETHYLENE INSENSITIVE3.2015 · DOI: 10.1371/journal.pone.0137439 Activation of the ethylene gas response pathway in Arabidopsis by the nuclear protein ETHYLENE-INSENSITIVE3 and related proteins.1997 · DOI: 10.1016/s0092-8674(00)80300-1 Nuclear events in ethylene signaling: a transcriptional cascade mediated by ETHYLENE-INSENSITIVE3 and ETHYLENE-RESPONSE-FACTOR1.1998 · DOI: 10.1101/gad.12.23.3703

Rice

Reference gene ID	Possible function	Papers / DOI
`Os03g0324300`	Transcription factor acting as a positive regulator in the ethylene response pathway.	MAOHUZI6/ETHYLENE INSENSITIVE3-LIKE1 and ETHYLENE INSENSITIVE3-LIKE2 Regulate Ethylene Response of Roots and Coleoptiles and Negatively Affect Salt Tolerance in Rice.2015 · DOI: 10.1104/pp.15.00353 Ethylene-gibberellin signaling underlies adaptation of rice to periodic flooding.2018 · DOI: 10.1126/science.aat1577
`Os03g0324200`	Transcription factor acting as a positive regulator in the ethylene response pathway.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_014220 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0001666 response to hypoxia Biological Process

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0009723 response to ethylene Biological Process

GO:0009871 jasmonic acid and ethylene-dependent systemic resistance, ethylene mediated signaling pathway Biological Process

GO:0009873 ethylene-activated signaling pathway Biological Process

GO:0009970 cellular response to sulfate starvation Biological Process

GO:0010104 regulation of ethylene-activated signaling pathway Biological Process

GO:0010182 sugar mediated signaling pathway Biological Process

GO:0040029 epigenetic regulation of gene expression Biological Process

GO:0042742 defense response to bacterium Biological Process

GO:0045893 positive regulation of DNA-templated transcription Biological Process

KEGG gene cross-reference

ath:AT2G27050

ath:AT3G20770

dosa:Os03g0324300

dosa:Os07g0685700

osa:4344331

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.977

Rank 1 · TkA01G158550 · TK1151

Cytoplasm0.089

Rank 2 · TkA01G158550 · TK1151

Cell membrane0.023

Rank 3 · TkA01G158550 · TK1151

Endoplasmic reticulum0.013

Rank 4 · TkA01G158550 · TK1151

Plastid0.011

Rank 5 · TkA01G158550 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF27048EIN3_N44-55 aa

PF04873EIN3_DNA-bd52-72 aa

PF27048EIN3_N77-148 aa

PF04873EIN3_DNA-bd84-139 aa

PF04873EIN3_DNA-bd166-287 aa

PF16101PRIMA1348-365 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G158550	`PF27048`	EIN3_N	44	55	1.8e-44	150.0
TkA01G158550	`PF04873`	EIN3_DNA-bd	52	72	7.9e-65	217.2
TkA01G158550	`PF27048`	EIN3_N	77	148	1.8e-44	150.0
TkA01G158550	`PF04873`	EIN3_DNA-bd	84	139	7.9e-65	217.2
TkA01G158550	`PF04873`	EIN3_DNA-bd	166	287	7.9e-65	217.2
TkA01G158550	`PF16101`	PRIMA1	348	365	8.4	6.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O23116`	Arabidopsis thaliana	sp\|O23116\|EIL3_ARATH ETHYLENE INSENSITIVE 3-like 3 protein	73.500%	Swiss-Prot	Low
`Q9SLH0`	Arabidopsis thaliana	sp\|Q9SLH0\|EIL1_ARATH ETHYLENE INSENSITIVE 3-like 1 protein	73.000%	Swiss-Prot	Low
`O24606`	Arabidopsis thaliana	sp\|O24606\|EIN3_ARATH Protein ETHYLENE INSENSITIVE 3	72.700%	Swiss-Prot	Low
`Q10M41`	Oryza sativa subsp. japonica	sp\|Q10M41\|EIL1A_ORYSJ Protein ETHYLENE-INSENSITIVE 3-like 1a	66.500%	Swiss-Prot	Low
`Q8W3M0`	Oryza sativa subsp. japonica	sp\|Q8W3M0\|EIL1B_ORYSJ Protein ETHYLENE-INSENSITIVE 3-like 1b	66.500%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card