LXL04_014220 | RubberDandelionOmics

Gene overview

LXL04_014220

Reference: OH-1004 Chr: Chr03 Coordinates: 43883876-43885696 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1821 bp · LXL04_014220|LXL04_014220|OH1004|cDNA

ATGGGGATCTTTGAAGAAATGGGTTTCTATGGAAATCTCGATTTCCTATCAGCTCCGCCGTGTGAAGGGGAAAAGCCGCCGGAAGTTGAGCAGGAGGCGCCAATGGAGGACGATTACAGTGACGAAGAAATGGATGTTGATGAGCTGGAAAGGAGGATGTGGAGAGATCGAATGCTTTTGAGGCGACTTAAAGATCAAAATAAAGGTAAAGAAGTGGATAACGCCAAACAGCGTCAATCTCAAGAACAAGCGAGACGAAA...

CDS

Download CDS FASTA

1821 bp · LXL04_014220|LXL04_014220|OH1004|CDS

ATGGGGATCTTTGAAGAAATGGGTTTCTATGGAAATCTCGATTTCCTATCAGCTCCGCCGTGTGAAGGGGAAAAGCCGCCGGAAGTTGAGCAGGAGGCGCCAATGGAGGACGATTACAGTGACGAAGAAATGGATGTTGATGAGCTGGAAAGGAGGATGTGGAGAGATCGAATGCTTTTGAGGCGACTTAAAGATCAAAATAAAGGTAAAGAAGTGGATAACGCCAAACAGCGTCAATCTCAAGAACAAGCGAGACGAAA...

Protein

Download Protein FASTA

606 aa · LXL04_014220|LXL04_014220|OH1004|PROTEIN

MGIFEEMGFYGNLDFLSAPPCEGEKPPEVEQEAPMEDDYSDEEMDVDELERRMWRDRMLLRRLKDQNKGKEVDNAKQRQSQEQARRKKMSRAQDGILKYMLKMMEVCKAQGFVYGIIPENGKPVSGASDNLRAWWKEKVRFDRNGPAAIAKYQADHSVSGKNEDSCAVVSTPHTLQELQDTTLGSLLSALMQHCDPPQRRFPLEKGVAPPWWPSGDEEWWSQLGLPKEQGTPPYKKPHDLKKAWKVGVLTAVIKHMSPDI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_014220`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_014220

Location Chr03:43883876-43885696 (+)

Description Similar to EIN3: Protein ETHYLENE INSENSITIVE 3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g20770`	Transcription factor acting as a positive regulator in the ethylene response pathway, by promoting histone acetylation in an ENAP1-dependent manner, thus accelerating the expression of ethylene- responsive genes.	Biochemical and Structural Insights into the Mechanism of DNA Recognition by Arabidopsis ETHYLENE INSENSITIVE3.2015 · DOI: 10.1371/journal.pone.0137439 Activation of the ethylene gas response pathway in Arabidopsis by the nuclear protein ETHYLENE-INSENSITIVE3 and related proteins.1997 · DOI: 10.1016/s0092-8674(00)80300-1 Nuclear events in ethylene signaling: a transcriptional cascade mediated by ETHYLENE-INSENSITIVE3 and ETHYLENE-RESPONSE-FACTOR1.1998 · DOI: 10.1101/gad.12.23.3703
`At2g27050`	Probable transcription factor acting as a positive regulator in the ethylene response pathway.	Activation of the ethylene gas response pathway in Arabidopsis by the nuclear protein ETHYLENE-INSENSITIVE3 and related proteins.1997 · DOI: 10.1016/s0092-8674(00)80300-1

Rice

Reference gene ID	Possible function	Papers / DOI
`Os03g0324200`	Transcription factor acting as a positive regulator in the ethylene response pathway.	No verified direct reference in this release
`Os03g0324300`	Transcription factor acting as a positive regulator in the ethylene response pathway.	MAOHUZI6/ETHYLENE INSENSITIVE3-LIKE1 and ETHYLENE INSENSITIVE3-LIKE2 Regulate Ethylene Response of Roots and Coleoptiles and Negatively Affect Salt Tolerance in Rice.2015 · DOI: 10.1104/pp.15.00353 Ethylene-gibberellin signaling underlies adaptation of rice to periodic flooding.2018 · DOI: 10.1126/science.aat1577
`Os07g0685700`	Transcription factor acting as a positive regulator in the ethylene response pathway.	Involvement of two rice ETHYLENE INSENSITIVE3-LIKE genes in wound signaling.2009 · DOI: 10.1007/s00438-009-0483-1 MAOHUZI6/ETHYLENE INSENSITIVE3-LIKE1 and ETHYLENE INSENSITIVE3-LIKE2 Regulate Ethylene Response of Roots and Coleoptiles and Negatively Affect Salt Tolerance in Rice.2015 · DOI: 10.1104/pp.15.00353

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_014220 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0001666 response to hypoxia Biological Process

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0009723 response to ethylene Biological Process

GO:0009871 jasmonic acid and ethylene-dependent systemic resistance, ethylene mediated signaling pathway Biological Process

GO:0009873 ethylene-activated signaling pathway Biological Process

GO:0009970 cellular response to sulfate starvation Biological Process

GO:0010104 regulation of ethylene-activated signaling pathway Biological Process

GO:0010182 sugar mediated signaling pathway Biological Process

GO:0040029 epigenetic regulation of gene expression Biological Process

GO:0042742 defense response to bacterium Biological Process

GO:0045893 positive regulation of DNA-templated transcription Biological Process

KEGG gene cross-reference

ath:AT2G27050

ath:AT3G20770

dosa:Os03g0324300

dosa:Os07g0685700

osa:4344331

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.976

Rank 1 · LXL04_014220 · OH-1004

Cytoplasm0.092

Rank 2 · LXL04_014220 · OH-1004

Cell membrane0.023

Rank 3 · LXL04_014220 · OH-1004

Endoplasmic reticulum0.014

Rank 4 · LXL04_014220 · OH-1004

Plastid0.012

Rank 5 · LXL04_014220 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF27048.1EIN3_N81-152 aa

PF04873.20EIN3_DNA-bd170-293 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_014220	`PF27048.1`	EIN3_N	81	152	1.2e-45	153.8
LXL04_014220	`PF04873.20`	EIN3_DNA-bd	170	293	1.5e-71	238.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O24606`	Arabidopsis thaliana	Protein ETHYLENE INSENSITIVE 3	60.113%	Swiss-Prot	strong database homology
`Q9SLH0`	Arabidopsis thaliana	ETHYLENE INSENSITIVE 3-like 1 protein	61.597%	Swiss-Prot	strong database homology
`Q8W3M0`	Oryza sativa subsp. japonica	Protein ETHYLENE-INSENSITIVE 3-like 1b	56.301%	Swiss-Prot	strong database homology
`Q10M41`	Oryza sativa subsp. japonica	Protein ETHYLENE-INSENSITIVE 3-like 1a	56.301%	Swiss-Prot	strong database homology
`Q8W3L9`	Oryza sativa subsp. japonica	Protein ETHYLENE-INSENSITIVE 3-like 2	52.577%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card