TkA01G145660 | RubberDandelionOmics

Gene overview

TkA01G145660

Reference: TK1151 Chr: Chr01 Coordinates: 36919498-36921544 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

411 bp · TkA01G145660|TK1151|cDNA

ATGGATCGGTCAACGATCCTTCAATCAACGTCCGGGATCTTCCTCCCGTTACCCGCCCAACATGTCTCTGTCATCCGTGCGGGATCTTACTCTGAAGAACTTATCAAAACCGCCAAAACTATCGCATCACCTGGCCGCGATATCCTTGCCATTGACAAGTCAAATGCAACTTGTGGTAAGCGATTGGCATCAATTGCATTAGACAACACCGAAGCCAACAGACAAGCCTATAGACAACTTCTTTTAACCACTCCTGGGAA...

CDS

Download CDS FASTA

411 bp · TkA01G145660|TK1151|CDS

ATGGATCGGTCAACGATCCTTCAATCAACGTCCGGGATCTTCCTCCCGTTACCCGCCCAACATGTCTCTGTCATCCGTGCGGGATCTTACTCTGAAGAACTTATCAAAACCGCCAAAACTATCGCATCACCTGGCCGCGATATCCTTGCCATTGACAAGTCAAATGCAACTTGTGGTAAGCGATTGGCATCAATTGCATTAGACAACACCGAAGCCAACAGACAAGCCTATAGACAACTTCTTTTAACCACTCCTGGGAA...

Protein

Download Protein FASTA

136 aa · TkA01G145660|TK1151|PROTEIN

MDRSTILQSTSGIFLPLPAQHVSVIRAGSYSEELIKTAKTIASPGRDILAIDKSNATCGKRLASIALDNTEANRQAYRQLLLTTPGNCCMCTPYFGENLEDHAQVNDVLVEMGTYFQMFVNIMIDDYLDCFGAPDS

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G145660`
TK1151 ID	TkA01G145660
OH-1004 ID	LXL04_011310
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	89.500
Protein coverage (%)	TK1151 55.882 / OH-1004 19.144 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G145660

Location Chr01:36919498-36921544 (+)

Description Similar to FBA3: Fructose-bisphosphate aldolase 3, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g01140`	Plays a key role in glycolysis and gluconeogenesis.	No verified direct reference in this release
`At4g38970`	Plays a key role in glycolysis and gluconeogenesis.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os11g0171300`	Plays a key role in glycolysis and gluconeogenesis.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_011310 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006094 gluconeogenesis Biological Process

GO:0006096 glycolytic process Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0030388 fructose 1,6-bisphosphate metabolic process Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009534 chloroplast thylakoid Cellular Component

GO:0009536 plastid Cellular Component

GO:0009570 chloroplast stroma Cellular Component

KEGG gene cross-reference

ath:AT2G01140

ath:AT2G21330

ath:AT4G38970

dosa:Os11g0171300

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.283

Rank 1 · TkA01G145660 · TK1151

Extracellular0.209

Rank 2 · TkA01G145660 · TK1151

Mitochondrion0.198

Rank 3 · TkA01G145660 · TK1151

Cytoplasm0.140

Rank 4 · TkA01G145660 · TK1151

Nucleus0.099

Rank 5 · TkA01G145660 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00274Glycolytic33-112 aa

PF09628YvfG91-128 aa

PF00348polyprenyl_synt93-135 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G145660	`PF00274`	Glycolytic	33	112	2.5e-18	66.7
TkA01G145660	`PF09628`	YvfG	91	128	0.056	14.6
TkA01G145660	`PF00348`	polyprenyl_synt	93	135	0.00067	19.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9ZU52`	Arabidopsis thaliana	sp\|Q9ZU52\|ALFP3_ARATH Fructose-bisphosphate aldolase 3, chloroplastic	81.400%	Swiss-Prot	Medium
`Q944G9`	Arabidopsis thaliana	sp\|Q944G9\|ALFP2_ARATH Fructose-bisphosphate aldolase 2, chloroplastic	62.800%	Swiss-Prot	Medium
`Q40677`	Oryza sativa subsp. japonica	sp\|Q40677\|ALFP_ORYSJ Fructose-bisphosphate aldolase, chloroplastic	73.200%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card