LXL04_011310 | RubberDandelionOmics

Gene overview

LXL04_011310

Reference: OH-1004 Chr: Chr02 Coordinates: 162362161-162364286 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1194 bp · LXL04_011310|LXL04_011310|OH1004|cDNA

ATGGCGTCTGCAAGCTTCGTGAAGTTAAATGCATCTTCGTCACCTTGGATCGGTCAACGATCCTTCAATCAACGTTCGGGATCTTCCTCCCGGTTACCCGCCCAGCGTGTCTCTGTCATCCGTGCGGGATCTTACTCCGAAGAACTTATCAAAACCGCTAAAACCATCGCATCACCTGGCCGCGGTATCCTTGCCATTGACGAGTCAAATGCAACCTGTGGGAAGCGATTAGCATCAATCGGCTTAGACAACACCGAAGC...

CDS

Download CDS FASTA

1194 bp · LXL04_011310|LXL04_011310|OH1004|CDS

ATGGCGTCTGCAAGCTTCGTGAAGTTAAATGCATCTTCGTCACCTTGGATCGGTCAACGATCCTTCAATCAACGTTCGGGATCTTCCTCCCGGTTACCCGCCCAGCGTGTCTCTGTCATCCGTGCGGGATCTTACTCCGAAGAACTTATCAAAACCGCTAAAACCATCGCATCACCTGGCCGCGGTATCCTTGCCATTGACGAGTCAAATGCAACCTGTGGGAAGCGATTAGCATCAATCGGCTTAGACAACACCGAAGC...

Protein

Download Protein FASTA

397 aa · LXL04_011310|LXL04_011310|OH1004|PROTEIN

MASASFVKLNASSSPWIGQRSFNQRSGSSSRLPAQRVSVIRAGSYSEELIKTAKTIASPGRGILAIDESNATCGKRLASIGLDNTEANRQAYRQLLLTTPGLGQYISGSILFEETLYQSTTDGKKMVDCLREQNIVPGIKGLVPLPGSNNESWCQGLDGLASRTAEYYSQGARFAKWRTVVSIPCGPSALAVKEAAWGLARYAAISQDNGLVPIVEPEILLDGDHPIERTLEVAERVWAEVFYYLAENNVMFEGILLKPS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_011310`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_011310

Location Chr02:162362161-162364286 (+)

Description Similar to FBA3: Fructose-bisphosphate aldolase 3, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g01140`	Plays a key role in glycolysis and gluconeogenesis.	No verified direct reference in this release
`At4g38970`	Plays a key role in glycolysis and gluconeogenesis.	No verified direct reference in this release
`At2g21330`	Plays a key role in glycolysis and gluconeogenesis.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os11g0171300`	Plays a key role in glycolysis and gluconeogenesis.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_011310 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006094 gluconeogenesis Biological Process

GO:0006096 glycolytic process Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0030388 fructose 1,6-bisphosphate metabolic process Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009534 chloroplast thylakoid Cellular Component

GO:0009536 plastid Cellular Component

GO:0009570 chloroplast stroma Cellular Component

KEGG gene cross-reference

ath:AT2G01140

ath:AT2G21330

ath:AT4G38970

dosa:Os11g0171300

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.927

Rank 1 · LXL04_011310 · OH-1004

Mitochondrion0.107

Rank 2 · LXL04_011310 · OH-1004

Cytoplasm0.080

Rank 3 · LXL04_011310 · OH-1004

Peroxisome0.043

Rank 4 · LXL04_011310 · OH-1004

Nucleus0.028

Rank 5 · LXL04_011310 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00274.26Glycolytic48-397 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_011310	`PF00274.26`	Glycolytic	48	397	3.1e-149	497.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9ZU52`	Arabidopsis thaliana	Fructose-bisphosphate aldolase 3, chloroplastic	85.037%	Swiss-Prot	strong database homology
`Q944G9`	Arabidopsis thaliana	Fructose-bisphosphate aldolase 2, chloroplastic	75.123%	Swiss-Prot	strong database homology
`Q9SJU4`	Arabidopsis thaliana	Fructose-bisphosphate aldolase 1, chloroplastic	73.464%	Swiss-Prot	strong database homology
`Q40677`	Oryza sativa subsp. japonica	Fructose-bisphosphate aldolase, chloroplastic	73.134%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card