TkA01G121490 | RubberDandelionOmics

Gene overview

TkA01G121490

Reference: TK1151 Chr: Chr01 Coordinates: 30751188-30752890 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1242 bp · TkA01G121490|TK1151|cDNA

GTCAAGTTGACCTTTGCAATTTTGAAGGTAAATATCGATTCTCCGATGATGCTCGAATTGTTCCAGGCCTGTAAATGGCAAGCGTTAAGCAAGGATGCGATATATCGCAGAAGGATCATTAGCGAGTGCAGTTACGCGTAACTTTTACCCACCTGTCCTCTCAATTTCTTCAAAACCGCCATTAATTTCCCCAATCGATCTTATATACAAACCCCAGAATACCCACAATCTGAATTCAGAAACATGTCGTACTCCCATTA...

CDS

Download CDS FASTA

765 bp · TkA01G121490|TK1151|CDS

ATGTCGTACTCCCATTACACTTCAGGCTACAACACCTCCCCTTCTGCACCGCCCGTGCCGGAAAACCAATCACAATCCGGCGGTGGTTACCCCTACCAACGTCCTCCCTCATCTCAACAACCTAATTACAATTACAATTACGGGCAGCCTCAGAACCCGACTAGTGCTGGTGGTGGTGGGTATGGTTCGCCATATGGGTACGCACCGGCACCGGCACCGAACCCGCCGTCGTTTCCACCAGGTACTCACCCGGAAGTCAT...

Protein

Download Protein FASTA

254 aa · TkA01G121490|TK1151|PROTEIN

MSYSHYTSGYNTSPSAPPVPENQSQSGGGYPYQRPPSSQQPNYNYNYGQPQNPTSAGGGGYGSPYGYAPAPAPNPPSFPPGTHPEVIRSFQMVDSDRSGFIDAKELQRALSSGYQQFSLRTIRLLMFLFGNSADPHRIGPKEFAELWSCLGQWRGIFERFDRDRSGKIDLAELRDALYSLGFAIPPTVLQLLISKYDDQSGRRADLSFDSFVECGMIVKGLTEKFKEKDTRYTGSATLSYETFMTMVIPFLAAE

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G121490`
TK1151 ID	TkA01G121490
OH-1004 ID	LXL04_004696
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	96.900
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G121490

Location Chr01:30751188-30752890 (+)

Description Similar to CBP: Calcium-binding protein CBP

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g27480`	Potential calcium sensor.	No verified direct reference in this release
`At3g10300`	Potential calcium sensor.	No verified direct reference in this release
`At5g04170`	Potential calcium sensor.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os12g0137100`	Potential calcium sensor.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_004696 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006888 endoplasmic reticulum to Golgi vesicle-mediated transport Biological Process

GO:0009610 response to symbiotic fungus Biological Process

GO:0048208 COPII vesicle coating Biological Process

GO:1902527 positive regulation of protein monoubiquitination Biological Process

GO:0005634 nucleus Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0030127 COPII vesicle coat Cellular Component

GO:0031463 Cul3-RING ubiquitin ligase complex Cellular Component

GO:0005509 calcium ion binding Molecular Function

GO:0048306 calcium-dependent protein binding Molecular Function

GO:1990756 ubiquitin-like ligase-substrate adaptor activity Molecular Function

KEGG gene cross-reference

ath:AT2G27480

ath:AT3G10300

ath:AT5G04170

dosa:Os12g0137100

osa:4351450

xla:495978

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.730

Rank 1 · TkA01G121490 · TK1151

Nucleus0.365

Rank 2 · TkA01G121490 · TK1151

Cell membrane0.091

Rank 3 · TkA01G121490 · TK1151

Endoplasmic reticulum0.055

Rank 4 · TkA01G121490 · TK1151

Lysosome / Vacuole0.051

Rank 5 · TkA01G121490 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF23564EF-hand_FSTL185-111 aa

PF00036EF-hand_186-112 aa

PF13405EF-hand_687-112 aa

PF13202EF-hand_587-108 aa

PF13499EF-hand_788-146 aa

PF14658EF-hand_989-110 aa

PF24548EF_EFCAB10_C90-111 aa

PF25578EF-hand_STIM191-107 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G121490	`PF23564`	EF-hand_FSTL1	85	111	0.04	15.0
TkA01G121490	`PF00036`	EF-hand_1	86	112	5.1e-15	54.5
TkA01G121490	`PF13405`	EF-hand_6	87	112	2.6e-15	55.3
TkA01G121490	`PF13202`	EF-hand_5	87	108	6.9e-13	48.1
TkA01G121490	`PF13499`	EF-hand_7	88	146	3.5e-14	53.6
TkA01G121490	`PF14658`	EF-hand_9	89	110	0.0013	19.9
TkA01G121490	`PF24548`	EF_EFCAB10_C	90	111	0.066	13.6
TkA01G121490	`PF25578`	EF-hand_STIM1	91	107	0.16	12.8
TkA01G121490	`PF13833`	EF-hand_8	98	125	0.00069	20.0
TkA01G121490	`PF00036`	EF-hand_1	138	148	5.1e-15	54.5
TkA01G121490	`PF21008`	AIF-1	145	213	0.14	13.2
TkA01G121490	`PF13405`	EF-hand_6	153	181	2.6e-15	55.3
TkA01G121490	`PF00036`	EF-hand_1	153	179	5.1e-15	54.5
TkA01G121490	`PF13499`	EF-hand_7	153	199	3.5e-14	53.6
TkA01G121490	`PF23564`	EF-hand_FSTL1	155	176	0.04	15.0
TkA01G121490	`PF13202`	EF-hand_5	156	175	6.9e-13	48.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9ZQH1`	Arabidopsis thaliana	sp\|Q9ZQH1\|CML48_ARATH Probable calcium-binding protein CML48	59.900%	Swiss-Prot	Medium
`Q8W4L0`	Arabidopsis thaliana	sp\|Q8W4L0\|CML49_ARATH Probable calcium-binding protein CML49	59.200%	Swiss-Prot	High
`Q9FYE4`	Arabidopsis thaliana	sp\|Q9FYE4\|CML50_ARATH Probable calcium-binding protein CML50	59.200%	Swiss-Prot	High
`Q2QY10`	Oryza sativa subsp. japonica	sp\|Q2QY10\|CBP_ORYSJ Calcium-binding protein CBP	59.800%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card