Gene Card
Gene overview
cDNA / CDS / Protein Sequences
450 bp · TkA01G118060|TK1151|cDNA
ATGTCGAGGAGCCTGAACTTCAACAAAAGCAGCGAGGAGAGTCAGAATAAGGGGCGGAGAAGCTCTCAGATAGTTCTGACTTTGAGGAAGAAGATGATTCCGATCACTCCAAATCGGAAAAAATATTTCATGGAATCAAATTGTTCAGTGGGTCGGTTTAAATGGCAGATAGTTCAGATCTGGATTCGTTCAACAGGTTTCAAGATCTGTGTTCTTCGATTGTGCGGCGGAAGAAGACGAGACCAGATCCAGGAAGAAGA...
450 bp · TkA01G118060|TK1151|CDS
ATGTCGAGGAGCCTGAACTTCAACAAAAGCAGCGAGGAGAGTCAGAATAAGGGGCGGAGAAGCTCTCAGATAGTTCTGACTTTGAGGAAGAAGATGATTCCGATCACTCCAAATCGGAAAAAATATTTCATGGAATCAAATTGTTCAGTGGGTCGGTTTAAATGGCAGATAGTTCAGATCTGGATTCGTTCAACAGGTTTCAAGATCTGTGTTCTTCGATTGTGCGGCGGAAGAAGACGAGACCAGATCCAGGAAGAAGA...
Protein
Download Protein FASTA149 aa · TkA01G118060|TK1151|PROTEIN
MSRSLNFNKSSEESQNKGRRSSQIVLTLRKKMIPITPNRKKYFMESNCSVGRFKWQIVQIWIRSTGFKICVLRLCGGRRRDQIQEEDDDEQESGGFSEKLDLKKMIGELDLPEIPSVFICPISLEPMGFLEMVLTHLTSLTHHLHPVSG
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA01G118060 |
|---|---|
| TK1151 ID | TkA01G118060 |
| OH-1004 ID | LXL04_014104 |
| Relationship / confidence | Non Reciprocal Best Hit / Complex relationship |
| Protein identity (%) | 67.200 |
| Protein coverage (%) | TK1151 42.953 / OH-1004 59.804Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA01G118060 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr01:29908234-29908976 (+) | |||||||||
| Description | Similar to PUB31: U-box domain-containing protein 31 | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0006952 defense response Biological Process GO:0007166 cell surface receptor signaling pathway Biological Process GO:0009742 brassinosteroid mediated signaling pathway Biological Process GO:0009908 flower development Biological Process GO:0016567 protein ubiquitination Biological Process GO:0031348 negative regulation of defense response Biological Process GO:0043069 negative regulation of programmed cell death Biological Process GO:0048586 regulation of long-day photoperiodism, flowering Biological Process GO:0071472 cellular response to salt stress Biological Process GO:1900457 regulation of brassinosteroid mediated signaling pathway Biological Process GO:1901001 negative regulation of response to salt stress Biological Process GO:2000028 regulation of photoperiodism, flowering Biological Process | |||||||||
| KEGG gene cross-reference | ath:AT3G49810 ath:AT5G65920 dosa:Os03g0232600 dosa:Os12g0570000 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
No result was found for this query.
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.