LXL04_014104 | RubberDandelionOmics

Gene overview

LXL04_014104

Reference: OH-1004 Chr: Chr03 Coordinates: 42085140-42085448 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

309 bp · LXL04_014104|LXL04_014104|OH1004|cDNA

ATGAACAGTAAGCGAGACCAGATccaggaagaagaagatgatgaatatGAAAGTGGTGGGTTTTCTGAGAAATTGGATCTGAAAAAGATGATTGGAGAGTTGGATTTTCCGGAGATTCCATCGATGTTCATTTGCCCGATTTCACTTGAACCGATGGAAGACCCAGTCACCCTGTGCACCAGCCAAACCTACGAGCGATCCAACATCTTGAAATGGTTCGCCAACGGCCATTTCACCTGCCCGACGACGATGCAAGAACT...

CDS

Download CDS FASTA

309 bp · LXL04_014104|LXL04_014104|OH1004|CDS

ATGAACAGTAAGCGAGACCAGATCCAGGAAGAAGAAGATGATGAATATGAAAGTGGTGGGTTTTCTGAGAAATTGGATCTGAAAAAGATGATTGGAGAGTTGGATTTTCCGGAGATTCCATCGATGTTCATTTGCCCGATTTCACTTGAACCGATGGAAGACCCAGTCACCCTGTGCACCAGCCAAACCTACGAGCGATCCAACATCTTGAAATGGTTCGCCAACGGCCATTTCACCTGCCCGACGACGATGCAAGAACT...

Protein

Download Protein FASTA

102 aa · LXL04_014104|LXL04_014104|OH1004|PROTEIN

MNSKRDQIQEEEDDEYESGGFSEKLDLKKMIGELDFPEIPSMFICPISLEPMEDPVTLCTSQTYERSNILKWFANGHFTCPTTMQELCPTAISSRQRPLVPK

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_014104`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_014104

Location Chr03:42085140-42085448 (-)

Description Similar to PUB31: U-box domain-containing protein 31

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g65920`	Functions as an E3 ubiquitin ligase.	No verified direct reference in this release
`At3g49810`	Functions as an E3 ubiquitin ligase.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os03g0232600`	E3 ubiquitin ligase that may function as positive regulator of brassinosteroid (BR) signaling.	The U-box E3 ubiquitin ligase TUD1 functions with a heterotrimeric G α subunit to regulate Brassinosteroid-mediated growth in rice.2013 · DOI: 10.1371/journal.pgen.1003391 An E3 ubiquitin ligase, ERECT LEAF1, functions in brassinosteroid signaling of rice.2013 · DOI: 10.4161/psb.27117
`Os12g0570000`	E3 ubiquitin-protein ligase that negatively regulates programmed cell death and disease resistance.	Spotted leaf11, a negative regulator of plant cell death and defense, encodes a U-box/armadillo repeat protein endowed with E3 ubiquitin ligase activity.2004 · DOI: 10.1105/tpc.104.025171 SPIN1, a K homology domain protein negatively regulated and ubiquitinated by the E3 ubiquitin ligase SPL11, is involved in flowering time control in rice.2008 · DOI: 10.1105/tpc.108.058610
`UniProt: A2ZLU6`	Defense related protein that negatively regulates programmed cell death.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_014104 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006952 defense response Biological Process

GO:0007166 cell surface receptor signaling pathway Biological Process

GO:0009742 brassinosteroid mediated signaling pathway Biological Process

GO:0009908 flower development Biological Process

GO:0016567 protein ubiquitination Biological Process

GO:0031348 negative regulation of defense response Biological Process

GO:0043069 negative regulation of programmed cell death Biological Process

GO:0048586 regulation of long-day photoperiodism, flowering Biological Process

GO:0071472 cellular response to salt stress Biological Process

GO:1900457 regulation of brassinosteroid mediated signaling pathway Biological Process

GO:1901001 negative regulation of response to salt stress Biological Process

GO:2000028 regulation of photoperiodism, flowering Biological Process

KEGG gene cross-reference

ath:AT3G49810

ath:AT5G65920

dosa:Os03g0232600

dosa:Os12g0570000

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.663

Rank 1 · LXL04_014104 · OH-1004

Cytoplasm0.483

Rank 2 · LXL04_014104 · OH-1004

Cell membrane0.046

Rank 3 · LXL04_014104 · OH-1004

Mitochondrion0.036

Rank 4 · LXL04_014104 · OH-1004

Endoplasmic reticulum0.035

Rank 5 · LXL04_014104 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF04564.22U-box39-90 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_014104	`PF04564.22`	U-box	39	90	1.5e-11	45.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FHN9`	Arabidopsis thaliana	U-box domain-containing protein 31	83.077%	Swiss-Prot	moderate database homology
`Q058P4`	Arabidopsis thaliana	U-box domain-containing protein 30	81.538%	Swiss-Prot	moderate database homology
`Q10PI9`	Oryza sativa subsp. japonica	U-box domain-containing protein 75	54.762%	Swiss-Prot	strong database homology
`Q0IMG9`	Oryza sativa subsp. japonica	E3 ubiquitin-protein ligase SPL11	58.182%	Swiss-Prot	moderate database homology
`A2ZLU6`	Oryza sativa subsp. indica	Protein spotted leaf 11	58.182%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card