TkA01G112970 | RubberDandelionOmics

Gene overview

TkA01G112970

Reference: TK1151 Chr: Chr01 Coordinates: 28687637-28688194 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

558 bp · TkA01G112970|TK1151|cDNA

ATGGCACCAACTTTCCTCTACTCCGACGGCCTGATCATTGCCGGAATCTCCTTATTCACCGCCATCGTCTGCGAAGCCATCTCATGGCTCTTGATCTACCGCCGCAAGTCTTACAAATCCCTCACGTCCGCCATTGATAAAGCCTCCAAGAAACTCGAAACCATGAAAACGAGTCCAAAATCTCTAAAAAAATCCAAAGCGAAAAAGATCAACCGCGTTGAAGCTTCCCTGAACGAGTCCAGCAGAGATTTATTCCTCTC...

CDS

Download CDS FASTA

558 bp · TkA01G112970|TK1151|CDS

ATGGCACCAACTTTCCTCTACTCCGACGGCCTGATCATTGCCGGAATCTCCTTATTCACCGCCATCGTCTGCGAAGCCATCTCATGGCTCTTGATCTACCGCCGCAAGTCTTACAAATCCCTCACGTCCGCCATTGATAAAGCCTCCAAGAAACTCGAAACCATGAAAACGAGTCCAAAATCTCTAAAAAAATCCAAAGCGAAAAAGATCAACCGCGTTGAAGCTTCCCTGAACGAGTCCAGCAGAGATTTATTCCTCTC...

Protein

Download Protein FASTA

185 aa · TkA01G112970|TK1151|PROTEIN

MAPTFLYSDGLIIAGISLFTAIVCEAISWLLIYRRKSYKSLTSAIDKASKKLETMKTSPKSLKKSKAKKINRVEASLNESSRDLFLSKFKSGAVVALLLFIVFRVMNSLYEGKVVGKLPFVPVGIVQNMSHRGLRGDDPTDCSMVFLYFLCSISIRTNLQKLLGFSPPRGAPGAGMFPDASEKNL

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G112970`
TK1151 ID	TkA01G112970
OH-1004 ID	LXL04_014385
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	68.300
Protein coverage (%)	TK1151 97.838 / OH-1004 96.875 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA01G112970`
Location	Chr01:28687637-28688194 (+)
Description	Similar to Tmco1: Calcium load-activated calcium channel
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_014385` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0001503 ossification Biological Process GO:0006983 ER overload response Biological Process GO:0032469 endoplasmic reticulum calcium ion homeostasis Biological Process GO:0070588 calcium ion transmembrane transport Biological Process GO:0160063 multi-pass transmembrane protein insertion into ER membrane Biological Process GO:0000139 Golgi membrane Cellular Component GO:0005737 cytoplasm Cellular Component GO:0005739 mitochondrion Cellular Component GO:0005783 endoplasmic reticulum Cellular Component GO:0005789 endoplasmic reticulum membrane Cellular Component GO:0031966 mitochondrial membrane Cellular Component GO:0160064 multi-pass translocon complex Cellular Component
KEGG gene cross-reference	mmu:68944 pon:100172905 rno:289196 ssc:100151809 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.741

Rank 1 · TkA01G112970 · TK1151

Mitochondrion0.079

Rank 2 · TkA01G112970 · TK1151

Cytoplasm0.064

Rank 3 · TkA01G112970 · TK1151

Nucleus0.064

Rank 4 · TkA01G112970 · TK1151

Peroxisome0.050

Rank 5 · TkA01G112970 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01277Oleosin5-58 aa

PF13858DUF41998-100 aa

PF01956EMC3_TMCO112-166 aa

PF07249Cerato-platanin28-81 aa

PF07889DUF166439-81 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G112970	`PF01277`	Oleosin	5	58	0.083	13.4
TkA01G112970	`PF13858`	DUF4199	8	100	0.15	13.1
TkA01G112970	`PF01956`	EMC3_TMCO1	12	166	8.2e-32	111.0
TkA01G112970	`PF07249`	Cerato-platanin	28	81	0.23	12.3
TkA01G112970	`PF07889`	DUF1664	39	81	0.056	14.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card