Gene Card
Gene overview
cDNA / CDS / Protein Sequences
579 bp · LXL04_014385|LXL04_014385|OH1004|cDNA
ATGACATCCCTTTTCTCCACCTTCAAGTACTCCGACGGTCTAACAGTCGTCGGAATCTCTTTCTGCACCGCCGTCGTCTGCGAAGCCATCTCATGGCTCCTGATCTACCGCACTACATCTTATAAATCGCTAAAATCCTCCATCGACAAAGCCTCCAAGAAACTCGAAACCATGAAAACCGATTCAACTGTCACTGCCGCCCCCAAAAAGTCCAAAACGAAAAAAATAGATCGCGTAGAAACATCCTTGAAAGAGTCCAG...
579 bp · LXL04_014385|LXL04_014385|OH1004|CDS
ATGACATCCCTTTTCTCCACCTTCAAGTACTCCGACGGTCTAACAGTCGTCGGAATCTCTTTCTGCACCGCCGTCGTCTGCGAAGCCATCTCATGGCTCCTGATCTACCGCACTACATCTTATAAATCGCTAAAATCCTCCATCGACAAAGCCTCCAAGAAACTCGAAACCATGAAAACCGATTCAACTGTCACTGCCGCCCCCAAAAAGTCCAAAACGAAAAAAATAGATCGCGTAGAAACATCCTTGAAAGAGTCCAG...
Protein
Download Protein FASTA192 aa · LXL04_014385|LXL04_014385|OH1004|PROTEIN
MTSLFSTFKYSDGLTVVGISFCTAVVCEAISWLLIYRTTSYKSLKSSIDKASKKLETMKTDSTVTAAPKKSKTKKIDRVETSLKESSRDLSLFKFKSGGVVALVLFVVFGFLNNLFEGKAVAKLPFVPARIVQKMSHRGLQGDDATDCSMAFLYFLCSISIRTNLQKFLGFAPPRGAAGAGMFQIPDPAKTN
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_014385 |
|---|---|
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_014385 |
|---|---|
| Location | Chr03:48076210-48076788 (+) |
| Description | Similar to Tmco1: Calcium load-activated calcium channel |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0001503 ossification Biological Process GO:0006983 ER overload response Biological Process GO:0032469 endoplasmic reticulum calcium ion homeostasis Biological Process GO:0070588 calcium ion transmembrane transport Biological Process GO:0160063 multi-pass transmembrane protein insertion into ER membrane Biological Process GO:0000139 Golgi membrane Cellular Component GO:0005737 cytoplasm Cellular Component GO:0005739 mitochondrion Cellular Component GO:0005783 endoplasmic reticulum Cellular Component GO:0005789 endoplasmic reticulum membrane Cellular Component GO:0031966 mitochondrial membrane Cellular Component GO:0160064 multi-pass translocon complex Cellular Component |
| KEGG gene cross-reference | mmu:68944 pon:100172905 rno:289196 ssc:100151809 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF01956.22EMC3_TMCO115-172 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| LXL04_014385 | PF01956.22 | EMC3_TMCO1 | 15 | 172 | 7e-32 | 111.3 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.