TkA01G109920 | RubberDandelionOmics

Gene overview

TkA01G109920

Reference: TK1151 Chr: Chr01 Coordinates: 27918148-27919847 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

714 bp · TkA01G109920|TK1151|cDNA

ATGAAAAGCTCCATACAAGAAGCGGAGGAAGGGATATTTTCCGTCGTCGATTCCCTTCTCTTAAAAACCCAAATTCTGCCCGAGGATATAGATGTCGTGATCGTTACCTGCGGTTGCTTTTCACCCTCTCCTTCTCTTTCATCTCTTATTGTGAATCACTACAATCTGGAACCCGATGTGAAAACGTATAATCTTAGTGGAATGGGGTGTAGATCCGGCGTTATTTCTATCGATTTAGTTGTGCAGATCTTACGTGGGGG...

CDS

Download CDS FASTA

714 bp · TkA01G109920|TK1151|CDS

ATGAAAAGCTCCATACAAGAAGCGGAGGAAGGGATATTTTCCGTCGTCGATTCCCTTCTCTTAAAAACCCAAATTCTGCCCGAGGATATAGATGTCGTGATCGTTACCTGCGGTTGCTTTTCACCCTCTCCTTCTCTTTCATCTCTTATTGTGAATCACTACAATCTGGAACCCGATGTGAAAACGTATAATCTTAGTGGAATGGGGTGTAGATCCGGCGTTATTTCTATCGATTTAGTTGTGCAGATCTTACGTGGGGG...

Protein

Download Protein FASTA

237 aa · TkA01G109920|TK1151|PROTEIN

MKSSIQEAEEGIFSVVDSLLLKTQILPEDIDVVIVTCGCFSPSPSLSSLIVNHYNLEPDVKTYNLSGMGCRSGVISIDLVVQILRGGGWKIRNVLVVVTENITLNWYEQFLIRIEIRSDIDADELYMELKLFETLETSELSNPIDVLKFMKELDYFPNACIAYRIMLTIPVMVASAEMSFSKLKLLKSYLRSTMTQERLSGLAMISIENEILESINYEELINQFAIKNARRASRIIG

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G109920`
TK1151 ID	TkA01G109920
OH-1004 ID	LXL04_000999
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	93.700
Protein coverage (%)	TK1151 53.165 / OH-1004 14.720 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G109920

Location Chr01:27918148-27919847 (+)

Description Similar to ZMYM5: Zinc finger MYM-type protein 5

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g01120`	Contributes to cuticular wax and suberin biosynthesis.	KCS1 encodes a fatty acid elongase 3-ketoacyl-CoA synthase affecting wax biosynthesis in Arabidopsis thaliana.1999 · DOI: 10.1046/j.1365-313x.1999.00352.x Specific and differential inhibition of very-long-chain fatty acid elongases from Arabidopsis thaliana by different herbicides.2004 · DOI: 10.1073/pnas.0404600101 Substrate specificity of Arabidopsis 3-ketoacyl-CoA synthases.2006 · DOI: 10.1016/j.bbrc.2006.05.162
`At2g26640`	Active on both saturated and mono-unsaturated acyl chains C16 to C20.	Substrate specificity of Arabidopsis 3-ketoacyl-CoA synthases.2006 · DOI: 10.1016/j.bbrc.2006.05.162
`At1g04220`	Mediates the synthesis of VLCFAs from 22 to 26 carbons in length (e.g. C22, C24, C26).	Specific and differential inhibition of very-long-chain fatty acid elongases from Arabidopsis thaliana by different herbicides.2004 · DOI: 10.1073/pnas.0404600101 The DAISY gene from Arabidopsis encodes a fatty acid elongase condensing enzyme involved in the biosynthesis of aliphatic suberin in roots and the chalaza-micropyle region of seeds.2009 · DOI: 10.1111/j.1365-313x.2008.03674.x Two Arabidopsis 3-ketoacyl CoA synthase genes, KCS20 and KCS2/DAISY, are functionally redundant in cuticular wax and root suberin biosynthesis, but differentially controlled by osmotic stress.2009 · DOI: 10.1111/j.1365-313x.2009.03973.x
`At5g43760`	Mediates the synthesis of VLCFAs from 22 to 26 carbons in length (e.g. C22, C24, C26).	Specific and differential inhibition of very-long-chain fatty acid elongases from Arabidopsis thaliana by different herbicides.2004 · DOI: 10.1073/pnas.0404600101
`At2g16280`	Involved in the elongation of C22 to C24 fatty acids, which are precursors for the biosynthesis of cuticular waxes, aliphatic suberins, and membrane lipids, including sphingolipids and phospholipids.	Arabidopsis 3-ketoacyl-coenzyme a synthase9 is involved in the synthesis of tetracosanoic acids as precursors of cuticular waxes, suberins, sphingolipids, and phospholipids.2013 · DOI: 10.1104/pp.112.210450

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_000999 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000122 negative regulation of transcription by RNA polymerase II Biological Process

GO:0006351 DNA-templated transcription Biological Process

GO:0005634 nucleus Cellular Component

GO:0008270 zinc ion binding Molecular Function

GO:0046983 protein dimerization activity Molecular Function

KEGG gene cross-reference

bta:536389

hsa:79830

hsa:9205

mcf:101867372

mmu:219105

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.666

Rank 1 · TkA01G109920 · TK1151

Nucleus0.211

Rank 2 · TkA01G109920 · TK1151

Endoplasmic reticulum0.077

Rank 3 · TkA01G109920 · TK1151

Peroxisome0.068

Rank 4 · TkA01G109920 · TK1151

Mitochondrion0.051

Rank 5 · TkA01G109920 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08392FAE1_CUT1_RppA1-107 aa

PF05699Dimer_Tnp_hAT126-210 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G109920	`PF08392`	FAE1_CUT1_RppA	1	107	6e-37	128.2
TkA01G109920	`PF05699`	Dimer_Tnp_hAT	126	210	2.6e-14	53.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9MAM3`	Arabidopsis thaliana	sp\|Q9MAM3\|KCS1_ARATH 3-ketoacyl-CoA synthase 1	49.500%	Swiss-Prot	Low
`O48780`	Arabidopsis thaliana	sp\|O48780\|KCS11_ARATH 3-ketoacyl-CoA synthase 11	48.600%	Swiss-Prot	Low
`Q5XEP9`	Arabidopsis thaliana	sp\|Q5XEP9\|KCS2_ARATH 3-ketoacyl-CoA synthase 2	49.500%	Swiss-Prot	Low
`Q9FG87`	Arabidopsis thaliana	sp\|Q9FG87\|KCS20_ARATH 3-ketoacyl-CoA synthase 20	48.600%	Swiss-Prot	Low
`Q9SIX1`	Arabidopsis thaliana	sp\|Q9SIX1\|KCS9_ARATH 3-ketoacyl-CoA synthase 9	48.600%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card