TkA01G098920 | RubberDandelionOmics

Gene overview

TkA01G098920

Reference: TK1151 Chr: Chr01 Coordinates: 25025248-25029207 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2128 bp · TkA01G098920|TK1151|cDNA

AAAAAACATTAATTGTATGCTAGGCAAGATTATTTTTGCCGGTAGCGCGAGGCCTTTTTTTTCTATCAGTCTCACAAATATCACCAATTCCTGCCGATCGTTTCAGATAAAGAATCTTTATTCGAAAATTCCCCCAAATAAAGATTTATCTTTGCTTCTTCTCGTTGCCCGAAAAGGGTACCACACCCGTTACCTCTCTTCCCTCTCAAAATTTCACCAATTTCTCATATGATTTTGGTTCATAGTGTCCATACCCATAT...

CDS

Download CDS FASTA

924 bp · TkA01G098920|TK1151|CDS

ATGTTATTGCTCTTTTTGTTGTTTGTTTTGACTATTGGTTCGTCTGTTGAGTTAGGAATTGCCTCTCAGATTAATCGATTACCTCCTGAAGTGGTTAAGTACTTTACGGATCCAGATGCTATTGAACCGCCAGATATGCAACTGCTTTATCCGTTTGTGGAAGCTGCTTTGCCACTTGCGTATGGAGTTTTGGGTGTTCAGTTGTTTCATGAAGTTGGGCATTTTCTTGCTGCATTCCCGAAGAAAGTGAAATTGAGCAT...

Protein

Download Protein FASTA

307 aa · TkA01G098920|TK1151|PROTEIN

MLLLFLLFVLTIGSSVELGIASQINRLPPEVVKYFTDPDAIEPPDMQLLYPFVEAALPLAYGVLGVQLFHEVGHFLAAFPKKVKLSIPFFIPNITLGSFGAITQFKSILPDRKTKVDVSLAGPFAGAALSLSMFGVGLLLSSKPDAAADMVQVPSMLFQGSFLLGLITRATLGYTAMHGATVAIHPLVIAGWCGLTTSALNMLPVGCLDGAESCSGAFGKDALVGFGLTTYSLLGFGILGGPLSLPWGLYVLICQRTPEK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G098920`
TK1151 ID	TkA01G098920
OH-1004 ID	LXL04_004889
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	98.000
Protein coverage (%)	TK1151 98.371 / OH-1004 52.705 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G098920

Location Chr01:25025248-25029207 (+)

Description Similar to EGY1: Probable zinc metalloprotease EGY1, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g35220`	Membrane-associated and ATP-independent metalloprotease required for development of both thylakoid grana and well-organized lamellae in chloroplast.	EGY1 encodes a membrane-associated and ATP-independent metalloprotease that is required for chloroplast development.2005 · DOI: 10.1111/j.1365-313x.2004.02308.x EGY1 plays a role in regulation of endodermal plastid size and number that are involved in ethylene-dependent gravitropism of light-grown Arabidopsis hypocotyls.2008 · DOI: 10.1007/s11103-007-9273-5 Arabidopsis plastid AMOS1/EGY1 integrates abscisic acid signaling to regulate global gene expression response to ammonium stress.2012 · DOI: 10.1104/pp.112.206508
`At5g35210`	Membrane-bound transcription factor required for the plastid-to-nucleus retrograde signaling.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os03g0792400`	Probable membrane-associated metalloprotease that may be involved in chloroplast development.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_004889 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006508 proteolysis Biological Process

GO:0009416 response to light stimulus Biological Process

GO:0009630 gravitropism Biological Process

GO:0009658 chloroplast organization Biological Process

GO:0009723 response to ethylene Biological Process

GO:0009959 negative gravitropism Biological Process

GO:0010019 chloroplast-nucleus signaling pathway Biological Process

GO:0010027 thylakoid membrane organization Biological Process

GO:0010207 photosystem II assembly Biological Process

GO:0043157 response to cation stress Biological Process

GO:0045893 positive regulation of DNA-templated transcription Biological Process

KEGG gene cross-reference

ath:AT5G35210

ath:AT5G35220

dosa:Os01g0142100

dosa:Os03g0792400

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.402

Rank 1 · TkA01G098920 · TK1151

Plastid0.287

Rank 2 · TkA01G098920 · TK1151

Golgi apparatus0.109

Rank 3 · TkA01G098920 · TK1151

Mitochondrion0.067

Rank 4 · TkA01G098920 · TK1151

Nucleus0.050

Rank 5 · TkA01G098920 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02163Peptidase_M5060-212 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G098920	`PF02163`	Peptidase_M50	60	212	7.4e-16	58.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q949Y5`	Arabidopsis thaliana	sp\|Q949Y5\|EGY1_ARATH Probable zinc metalloprotease EGY1, chloroplastic	82.500%	Swiss-Prot	High
`F4JYC8`	Arabidopsis thaliana	sp\|F4JYC8\|PTM_ARATH DDT domain-containing protein PTM	79.400%	Swiss-Prot	Medium
`Q852K0`	Oryza sativa subsp. japonica	sp\|Q852K0\|EGY1_ORYSJ Probable zinc metalloprotease EGY1, chloroplastic	78.900%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card