RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

LXL04_004889
Reference: OH-1004 Chr: Chr01 Coordinates: 149615699-149618759 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

1722 bp · LXL04_004889|LXL04_004889|OH1004|cDNA

ATGGGTACACTCACAAGCTGTAGTTTTACTAGTACACTGAATTTAGGGTTCCGTTTGAGACCTAATCGTATCGATTCGGCGGAAAGATTGCGACTTTACAACAGGGGAAATGATGGGTCCAGGAAGAACAATTATATTTTGTCTAGTAGAGAGCTTTTATCGAAAAAGAGGCGGCGGATTATAGGTTTAGATAGTGATAATAAGGGGTTTATTGCGGGATTTGAGTGTTCTGCTAGTGGCCGTGATGATAATAATAGTAA...

CDS

Download CDS FASTA

1722 bp · LXL04_004889|LXL04_004889|OH1004|CDS

ATGGGTACACTCACAAGCTGTAGTTTTACTAGTACACTGAATTTAGGGTTCCGTTTGAGACCTAATCGTATCGATTCGGCGGAAAGATTGCGACTTTACAACAGGGGAAATGATGGGTCCAGGAAGAACAATTATATTTTGTCTAGTAGAGAGCTTTTATCGAAAAAGAGGCGGCGGATTATAGGTTTAGATAGTGATAATAAGGGGTTTATTGCGGGATTTGAGTGTTCTGCTAGTGGCCGTGATGATAATAATAGTAA...

Protein

Download Protein FASTA

573 aa · LXL04_004889|LXL04_004889|OH1004|PROTEIN

MGTLTSCSFTSTLNLGFRLRPNRIDSAERLRLYNRGNDGSRKNNYILSSRELLSKKRRRIIGLDSDNKGFIAGFECSASGRDDNNSNDTSGNDGVEDDDMSKDSNLATISPEETTAGGKTDSEKPVPPPTISSRPPTISPIGSTYNNFHVDSFKLMELLGPEKVDPNDVKLIKDALFGYSTFWVTKEEPFGDLGEGILFLGNLRGNREEVFTKLQSQLAEIMGDKYNLFMVEEPNSEGDDPRGGPRVSFGMLRKEVSEPG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDLXL04_004889
TK1151 IDTkA01G098920
OH-1004 IDLXL04_004889
Relationship / confidenceSequence Supported Annotation Or Model Conflict / Review
Protein identity (%)98.000
Protein coverage (%)TK1151 98.371 / OH-1004 52.705
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionOH-1004 / GCA_047496595.1_OSU_TarKok_2.0
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDLXL04_004889
LocationChr01:149615699-149618759 (-)
DescriptionSimilar to EGY1: Probable zinc metalloprotease EGY1, chloroplastic
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At5g35220 Membrane-associated and ATP-independent metalloprotease required for development of both thylakoid grana and well-organized lamellae in chloroplast.
EGY1 encodes a membrane-associated and ATP-independent metalloprotease that is required for chloroplast development.2005 · DOI: 10.1111/j.1365-313x.2004.02308.x
EGY1 plays a role in regulation of endodermal plastid size and number that are involved in ethylene-dependent gravitropism of light-grown Arabidopsis hypocotyls.2008 · DOI: 10.1007/s11103-007-9273-5
Arabidopsis plastid AMOS1/EGY1 integrates abscisic acid signaling to regulate global gene expression response to ammonium stress.2012 · DOI: 10.1104/pp.112.206508
At5g35210 Membrane-bound transcription factor required for the plastid-to-nucleus retrograde signaling. No verified direct reference in this release

Rice

Reference gene IDPossible functionPapers / DOI
Os03g0792400 Probable membrane-associated metalloprotease that may be involved in chloroplast development. No verified direct reference in this release
Os01g0142100 Probable membrane-associated metalloprotease that may be involved in chloroplast development. No verified direct reference in this release
UniProt: B8AD72 Probable membrane-associated metalloprotease that may be involved in chloroplast development. No verified direct reference in this release
Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_004889 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)
GO:0006351 DNA-templated transcription Biological Process
GO:0006508 proteolysis Biological Process
GO:0009416 response to light stimulus Biological Process
GO:0009630 gravitropism Biological Process
GO:0009658 chloroplast organization Biological Process
GO:0009723 response to ethylene Biological Process
GO:0009959 negative gravitropism Biological Process
GO:0010019 chloroplast-nucleus signaling pathway Biological Process
GO:0010027 thylakoid membrane organization Biological Process
GO:0010207 photosystem II assembly Biological Process
GO:0043157 response to cation stress Biological Process
GO:0045893 positive regulation of DNA-templated transcription Biological Process
KEGG gene cross-reference
ath:AT5G35210
ath:AT5G35220
dosa:Os01g0142100
dosa:Os03g0792400
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.981
Rank 1 · LXL04_004889 · OH-1004
Mitochondrion0.022
Rank 2 · LXL04_004889 · OH-1004
Nucleus0.016
Rank 3 · LXL04_004889 · OH-1004
Cytoplasm0.013
Rank 4 · LXL04_004889 · OH-1004
Cell membrane0.011
Rank 5 · LXL04_004889 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF27677.1EGY3_M170-254 aa
PF02163.29Peptidase_M50326-485 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
LXL04_004889PF27677.1EGY3_M1702541.3e-2589.8
LXL04_004889PF02163.29Peptidase_M503264852.8e-1763.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q949Y5Arabidopsis thalianaProbable zinc metalloprotease EGY1, chloroplastic67.863%Swiss-Protstrong database homology
F4JYC8Arabidopsis thalianaDDT domain-containing protein PTM81.212%Swiss-Protweak database homology
Q852K0Oryza sativa subsp. japonicaProbable zinc metalloprotease EGY1, chloroplastic77.130%Swiss-Protstrong database homology
Q0JQS5Oryza sativa subsp. japonicaProbable zinc metalloprotease EGY2, chloroplastic30.155%Swiss-Protmoderate database homology
B8AD72Oryza sativa subsp. indicaProbable zinc metalloprotease EGY2, chloroplastic30.155%Swiss-Protmoderate database homology

JBrowse

View in Genome Browser