TkA01G078940 | RubberDandelionOmics

Gene overview

TkA01G078940

Reference: TK1151 Chr: Chr01 Coordinates: 20174371-20179335 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2553 bp · TkA01G078940|TK1151|cDNA

AAAATATCTGGTTTTGAATTAATGACGGAACCGATTACAGTTATTGAGGTCCCTAATATTATATATCAATTTAAGTTCAAACCGTGACTAGAAGACATTTTAATGTCCCACAACCACCACCCAACCGTAGCTTTCAAAATAAATGCAGGGCCACTCCCGCCCCACCCCAGCCCACAAATGGAGATAGAAGTGAGTAGCTTTGGTGGTGGTGGTGGTAGCCACAGTGGCAGTAGAATGGCGGAACATGGCGGTAGTAATGA...

CDS

Download CDS FASTA

2193 bp · TkA01G078940|TK1151|CDS

ATGTCCCACAACCACCACCCAACCGTAGCTTTCAAAATAAATGCAGGGCCACTCCCGCCCCACCCCAGCCCACAAATGGAGATAGAAGTGAGTAGCTTTGGTGGTGGTGGTGGTAGCCACAGTGGCAGTAGAATGGCGGAACATGGCGGTAGTAATGAGGGAGGTGGTGGTGGAATAAGTATGGGTCCGAGTCCGAGCATGAAGGAAAGGGCAAGTTATCTGGTGTGGCAAGATCTGAGAGTAATGCTCCCAAACTCTGG...

Protein

Download Protein FASTA

730 aa · TkA01G078940|TK1151|PROTEIN

MSHNHHPTVAFKINAGPLPPHPSPQMEIEVSSFGGGGGSHSGSRMAEHGGSNEGGGGGISMGPSPSMKERASYLVWQDLRVMLPNSGDGPTKRLLHGLNGFAEPGRIMAIMGPSGSGKSTLLDALAGRLSKNVVMAGDILLNGEKKKLTYGAVAYVTQEDILMGTLTVRETITYSAHLRLPPTLTKEEVQDTIEGTILEMGLEDCADRLIGNWHLRGISGGEKKRLSIALEILVRPRLMFLDEPTSGLDSASAFFVVQAL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G078940`
TK1151 ID	TkA01G078940
OH-1004 ID	LXL04_005164
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.300
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G078940

Location Chr01:20174371-20179335 (+)

Description Similar to ABCG15: ABC transporter G family member 15

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g21090`	ABC transporter G family member 15.	No verified direct reference in this release
`At1g51500`	Involved in the secretion of cuticular wax from epidermal cells to the cuticle, especially in the transport of aldehydes, alcohols and acids.	Cuticular waxes on eceriferum mutants of Arabidopsis thaliana.2001 · DOI: 10.1016/s0031-9422(00)00513-6 Plant cuticular lipid export requires an ABC transporter.2004 · DOI: 10.1126/science.1102331 Wax and cutin mutants of Arabidopsis: Quantitative characterization of the cuticular transport barrier in relation to chemical composition.2016 · DOI: 10.1016/j.bbalip.2016.03.002 The effects of surface structure mutations in Arabidopsis thaliana on the polarization of reflections from virus-infected leaves.2017 · DOI: 10.1371/journal.pone.0174014
`At1g51460`	ABC transporter G family member 13.	No verified direct reference in this release
`At1g17840`	Required for the cuticle, root suberin and pollen coat development by controlling cutin and maybe wax transport to the extracellular matrix.	Characterization of Arabidopsis ABCG11/WBC11, an ATP binding cassette (ABC) transporter that is required for cuticular lipid secretion.2007 · DOI: 10.1111/j.1365-313x.2007.03252.x The Arabidopsis DESPERADO/AtWBC11 transporter is required for cutin and wax secretion.2007 · DOI: 10.1104/pp.107.105676 Cytological and biochemical analysis of COF1, an Arabidopsis mutant of an ABC transporter gene.2007 · DOI: 10.1093/pcp/pcm139 An ABC transporter gene of Arabidopsis thaliana, AtWBC11, is involved in cuticle development and prevention of organ fusion.2007 · DOI: 10.1093/pcp/pcm152 The Arabidopsis DSO/ABCG11 transporter affects cutin metabolism in reproductive organs and suberin in roots.2010 · DOI: 10.1093/mp/ssp103 ABCG9, ABCG11 and ABCG14 ABC transporters are required for vascular development in Arabidopsis.2013 · DOI: 10.1111/tpj.12334 Expression analysis of transporter genes for screening candidate monolignol transporters using Arabidopsis thaliana cell suspensions during tracheary element differentiation.2018 · DOI: 10.1007/s10265-017-0979-4

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_005164 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006869 lipid transport Biological Process

GO:0009611 response to wounding Biological Process

GO:0009651 response to salt stress Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0010025 wax biosynthetic process Biological Process

GO:0010222 stem vascular tissue pattern formation Biological Process

GO:0010345 suberin biosynthetic process Biological Process

GO:0010588 cotyledon vascular tissue pattern formation Biological Process

GO:0010597 green leaf volatile biosynthetic process Biological Process

GO:0015908 fatty acid transport Biological Process

GO:0051607 defense response to virus Biological Process

GO:0055085 transmembrane transport Biological Process

KEGG gene cross-reference

ath:AT1G17840

ath:AT1G51460

ath:AT1G51500

ath:AT3G21090

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.778

Rank 1 · TkA01G078940 · TK1151

Endoplasmic reticulum0.098

Rank 2 · TkA01G078940 · TK1151

Cytoplasm0.096

Rank 3 · TkA01G078940 · TK1151

Lysosome / Vacuole0.067

Rank 4 · TkA01G078940 · TK1151

Golgi apparatus0.047

Rank 5 · TkA01G078940 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13191AAA_1693-154 aa

PF00005ABC_tran96-246 aa

PF13481AAA_2596-160 aa

PF00931NB-ARC98-124 aa

PF09818ABC_ATPase99-126 aa

PF00437T2SSE102-132 aa

PF01637ATPase_2103-130 aa

PF25199nSTAND_NTPase5104-130 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G078940	`PF13191`	AAA_16	93	154	0.00016	23.0
TkA01G078940	`PF00005`	ABC_tran	96	246	5.9e-25	89.2
TkA01G078940	`PF13481`	AAA_25	96	160	0.07	13.5
TkA01G078940	`PF00931`	NB-ARC	98	124	0.18	12.1
TkA01G078940	`PF09818`	ABC_ATPase	99	126	0.38	10.5
TkA01G078940	`PF00437`	T2SSE	102	132	0.12	11.7
TkA01G078940	`PF01637`	ATPase_2	103	130	0.32	11.5
TkA01G078940	`PF25199`	nSTAND_NTPase5	104	130	0.052	14.1
TkA01G078940	`PF03215`	Rad17	104	132	0.18	12.4
TkA01G078940	`PF13555`	AAA_29	105	126	4.9e-06	26.9
TkA01G078940	`PF03193`	RsgA_GTPase	105	133	0.0024	18.5
TkA01G078940	`PF13401`	AAA_22	105	134	0.0038	18.3
TkA01G078940	`PF20703`	nSTAND1	105	124	0.042	14.2
TkA01G078940	`PF02463`	SMC_N	106	277	2.4e-05	24.6
TkA01G078940	`PF05729`	NACHT	106	131	0.095	13.3
TkA01G078940	`PF13173`	AAA_14	106	132	0.18	12.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8RWI9`	Arabidopsis thaliana	sp\|Q8RWI9\|AB15G_ARATH ABC transporter G family member 15	68.500%	Swiss-Prot	High
`Q9C8K2`	Arabidopsis thaliana	sp\|Q9C8K2\|AB12G_ARATH ABC transporter G family member 12	68.000%	Swiss-Prot	High
`Q9C8J8`	Arabidopsis thaliana	sp\|Q9C8J8\|AB13G_ARATH ABC transporter G family member 13	58.800%	Swiss-Prot	High
`Q8RXN0`	Arabidopsis thaliana	sp\|Q8RXN0\|AB11G_ARATH ABC transporter G family member 11	56.600%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card