LXL04_005164 | RubberDandelionOmics

Gene overview

LXL04_005164

Reference: OH-1004 Chr: Chr01 Coordinates: 156842022-156846632 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2196 bp · LXL04_005164|LXL04_005164|OH1004|cDNA

ATGTCCCACAACCACCACCCAACCGTAGCTTTCAAAATAAATGCAGGGCCACTTCCGCCCCACCCCAGCCCACAAATGGAGATAGAAGTGAGTAGctttggtggtggtggtggtggtagcCACAGTGGCAGTAGAATGGCGGAACATGGCGGCAGTAATGAGGGAGGTGGTGGTGGAATAAGTATGGGTCCGAGTCCGAGCATGAAGGAAAGGGCAAGTTATCTGGTGTGGCAAGATCTGAGAGTAATGCTCCCAAACTC...

CDS

Download CDS FASTA

2196 bp · LXL04_005164|LXL04_005164|OH1004|CDS

ATGTCCCACAACCACCACCCAACCGTAGCTTTCAAAATAAATGCAGGGCCACTTCCGCCCCACCCCAGCCCACAAATGGAGATAGAAGTGAGTAGCTTTGGTGGTGGTGGTGGTGGTAGCCACAGTGGCAGTAGAATGGCGGAACATGGCGGCAGTAATGAGGGAGGTGGTGGTGGAATAAGTATGGGTCCGAGTCCGAGCATGAAGGAAAGGGCAAGTTATCTGGTGTGGCAAGATCTGAGAGTAATGCTCCCAAACTC...

Protein

Download Protein FASTA

731 aa · LXL04_005164|LXL04_005164|OH1004|PROTEIN

MSHNHHPTVAFKINAGPLPPHPSPQMEIEVSSFGGGGGGSHSGSRMAEHGGSNEGGGGGISMGPSPSMKERASYLVWQDLRVMLPNSGDGPTKRLLHGLNGFAEPGRIMAIMGPSGSGKSTLLDALAGRLSKNVVMAGDILLNGEKKKLTYGAVAYVTQEDILMGTLTVRETITYSAHLRLPPTLTKEEVQDTIEGTILEMGLEDCADRLIGNWHLRGISGGEKKRLSIALEILVRPRLMFLDEPTSGLDSASAFFVVQA...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_005164`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_005164

Location Chr01:156842022-156846632 (-)

Description Similar to ABCG15: ABC transporter G family member 15

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g21090`	ABC transporter G family member 15.	No verified direct reference in this release
`At1g51500`	Involved in the secretion of cuticular wax from epidermal cells to the cuticle, especially in the transport of aldehydes, alcohols and acids.	Cuticular waxes on eceriferum mutants of Arabidopsis thaliana.2001 · DOI: 10.1016/s0031-9422(00)00513-6 Plant cuticular lipid export requires an ABC transporter.2004 · DOI: 10.1126/science.1102331 Wax and cutin mutants of Arabidopsis: Quantitative characterization of the cuticular transport barrier in relation to chemical composition.2016 · DOI: 10.1016/j.bbalip.2016.03.002 The effects of surface structure mutations in Arabidopsis thaliana on the polarization of reflections from virus-infected leaves.2017 · DOI: 10.1371/journal.pone.0174014
`At1g51460`	ABC transporter G family member 13.	No verified direct reference in this release
`At1g17840`	Required for the cuticle, root suberin and pollen coat development by controlling cutin and maybe wax transport to the extracellular matrix.	Characterization of Arabidopsis ABCG11/WBC11, an ATP binding cassette (ABC) transporter that is required for cuticular lipid secretion.2007 · DOI: 10.1111/j.1365-313x.2007.03252.x The Arabidopsis DESPERADO/AtWBC11 transporter is required for cutin and wax secretion.2007 · DOI: 10.1104/pp.107.105676 Cytological and biochemical analysis of COF1, an Arabidopsis mutant of an ABC transporter gene.2007 · DOI: 10.1093/pcp/pcm139 An ABC transporter gene of Arabidopsis thaliana, AtWBC11, is involved in cuticle development and prevention of organ fusion.2007 · DOI: 10.1093/pcp/pcm152 The Arabidopsis DSO/ABCG11 transporter affects cutin metabolism in reproductive organs and suberin in roots.2010 · DOI: 10.1093/mp/ssp103 ABCG9, ABCG11 and ABCG14 ABC transporters are required for vascular development in Arabidopsis.2013 · DOI: 10.1111/tpj.12334 Expression analysis of transporter genes for screening candidate monolignol transporters using Arabidopsis thaliana cell suspensions during tracheary element differentiation.2018 · DOI: 10.1007/s10265-017-0979-4

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_005164 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006869 lipid transport Biological Process

GO:0009611 response to wounding Biological Process

GO:0009651 response to salt stress Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0010025 wax biosynthetic process Biological Process

GO:0010222 stem vascular tissue pattern formation Biological Process

GO:0010345 suberin biosynthetic process Biological Process

GO:0010588 cotyledon vascular tissue pattern formation Biological Process

GO:0010597 green leaf volatile biosynthetic process Biological Process

GO:0015908 fatty acid transport Biological Process

GO:0051607 defense response to virus Biological Process

GO:0055085 transmembrane transport Biological Process

KEGG gene cross-reference

ath:AT1G17840

ath:AT1G51460

ath:AT1G51500

ath:AT3G21090

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.784

Rank 1 · LXL04_005164 · OH-1004

Endoplasmic reticulum0.097

Rank 2 · LXL04_005164 · OH-1004

Cytoplasm0.095

Rank 3 · LXL04_005164 · OH-1004

Lysosome / Vacuole0.065

Rank 4 · LXL04_005164 · OH-1004

Golgi apparatus0.046

Rank 5 · LXL04_005164 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00005.34ABC_tran97-247 aa

PF13555.13AAA_29106-127 aa

PF19055.7ABC2_membrane_7276-330 aa

PF01061.30ABC2_membrane411-619 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_005164	`PF00005.34`	ABC_tran	97	247	5.9e-25	89.2
LXL04_005164	`PF13555.13`	AAA_29	106	127	4.9e-06	26.9
LXL04_005164	`PF19055.7`	ABC2_membrane_7	276	330	4e-10	39.9
LXL04_005164	`PF01061.30`	ABC2_membrane	411	619	6.8e-38	131.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8RWI9`	Arabidopsis thaliana	ABC transporter G family member 15	68.222%	Swiss-Prot	strong database homology
`Q9C8K2`	Arabidopsis thaliana	ABC transporter G family member 12	68.249%	Swiss-Prot	strong database homology
`Q9C8J8`	Arabidopsis thaliana	ABC transporter G family member 13	58.605%	Swiss-Prot	strong database homology
`Q8RXN0`	Arabidopsis thaliana	ABC transporter G family member 11	54.681%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card