TkA01G045020 | RubberDandelionOmics

Gene overview

TkA01G045020

Reference: TK1151 Chr: Chr01 Coordinates: 11629202-11629996 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

687 bp · TkA01G045020|TK1151|cDNA

ATGTCAAGTACATCTTTACCTTTGGTTTTGAGTTGCAAAAACTGTCCACCATGTAGCCCACCAAAATCTTCAAAGCCACACCCTCACCCATACCCTCCCTCCACCAAGCCACCGCATCATGGCGGAGGACCGAAGGTGTCACCGCCTAAAACTAAGCCACCGAAGACCCACCCACCAAAGGTTCGACCACCTATAGTCTGTCCACCACCCATTACTAGACCACCTATTGTACGGCCTCCACCGGTTACTAGACCACCACC...

CDS

Download CDS FASTA

687 bp · TkA01G045020|TK1151|CDS

ATGTCAAGTACATCTTTACCTTTGGTTTTGAGTTGCAAAAACTGTCCACCATGTAGCCCACCAAAATCTTCAAAGCCACACCCTCACCCATACCCTCCCTCCACCAAGCCACCGCATCATGGCGGAGGACCGAAGGTGTCACCGCCTAAAACTAAGCCACCGAAGACCCACCCACCAAAGGTTCGACCACCTATAGTCTGTCCACCACCCATTACTAGACCACCTATTGTACGGCCTCCACCGGTTACTAGACCACCACC...

Protein

Download Protein FASTA

228 aa · TkA01G045020|TK1151|PROTEIN

MSSTSLPLVLSCKNCPPCSPPKSSKPHPHPYPPSTKPPHHGGGPKVSPPKTKPPKTHPPKVRPPIVCPPPITRPPIVRPPPVTRPPPIVLPPIVMPPPVIVVPPPVLPPPVVNPPVISPPVITPPVILPPPSPSYPPYTPPACPINALKLGACVDALGGLVHIGLGNPVENVCCPVLKGLLELEAAVCLCTTIRLKLLNLNIFIPLALQVLVTCGMTPPPGFVCPPLL

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G045020`
TK1151 ID	TkA01G045020
OH-1004 ID	LXL04_018218
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	59.500
Protein coverage (%)	TK1151 34.649 / OH-1004 25.987 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G045020

Location Chr01:11629202-11629996 (-)

Description Similar to PRP2: Repetitive proline-rich cell wall protein 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g12490`	Probable lipid transfer protein (LTP).	Influence of EARLI1-like genes on flowering time and lignin synthesis of Arabidopsis thaliana.2011 · DOI: 10.1111/j.1438-8677.2010.00428.x
`At4g12500`	Probable lipid transfer protein (LTP).	No verified direct reference in this release
`At4g12470`	Probable lipid transfer protein (LTP).	Priming in systemic plant immunity.2009 · DOI: 10.1126/science.1170025 Cold-inducible expression of AZI1 and its function in improvement of freezing tolerance of Arabidopsis thaliana and Saccharomyces cerevisiae.2011 · DOI: 10.1016/j.jplph.2011.01.023 Influence of EARLI1-like genes on flowering time and lignin synthesis of Arabidopsis thaliana.2011 · DOI: 10.1111/j.1438-8677.2010.00428.x Metabolomic analysis reveals the relationship between AZI1 and sugar signaling in systemic acquired resistance of Arabidopsis.2016 · DOI: 10.1016/j.plaphy.2016.06.016
`At4g12480`	Probable lipid transfer protein (LTP).	Cold responsive EARLI1 type HyPRPs improve freezing survival of yeast cells and form higher order complexes in plants.2007 · DOI: 10.1007/s00425-007-0611-2 The HyPRP gene EARLI1 has an auxiliary role for germinability and early seedling development under low temperature and salt stress conditions in Arabidopsis thaliana.2011 · DOI: 10.1007/s00425-011-1425-9 Influence of EARLI1-like genes on flowering time and lignin synthesis of Arabidopsis thaliana.2011 · DOI: 10.1111/j.1438-8677.2010.00428.x Expression of recombinant EARLI1, a hybrid proline-rich protein of Arabidopsis, in Escherichia coli and its inhibition effect to the growth of fungal pathogens and Saccharomyces cerevisiae.2012 · DOI: 10.1016/j.gene.2012.06.070

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_018218 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0005576 extracellular region Cellular Component

GO:0005199 structural constituent of cell wall Molecular Function

KEGG gene cross-reference No functional description available

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.607

Rank 1 · TkA01G045020 · TK1151

Endoplasmic reticulum0.169

Rank 2 · TkA01G045020 · TK1151

Cell membrane0.108

Rank 3 · TkA01G045020 · TK1151

Cytoplasm0.102

Rank 4 · TkA01G045020 · TK1151

Plastid0.043

Rank 5 · TkA01G045020 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF14547Hydrophob_seed143-225 aa

PF00234Tryp_alpha_amyl143-224 aa

PF14368LTP_2143-224 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G045020	`PF14547`	Hydrophob_seed	143	225	1.3e-24	87.0
TkA01G045020	`PF00234`	Tryp_alpha_amyl	143	224	9.6e-12	45.7
TkA01G045020	`PF14368`	LTP_2	143	224	1.3e-05	26.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SU34`	Arabidopsis thaliana	sp\|Q9SU34\|ERLL2_ARATH pEARLI1-like lipid transfer protein 2	43.900%	Swiss-Prot	Low
`Q9SU33`	Arabidopsis thaliana	sp\|Q9SU33\|ERLL3_ARATH pEARLI1-like lipid transfer protein 3	42.900%	Swiss-Prot	Low
`Q9SU35`	Arabidopsis thaliana	sp\|Q9SU35\|ERLL1_ARATH pEARLI1-like lipid transfer protein 1	43.600%	Swiss-Prot	Low
`Q39176`	Arabidopsis thaliana	sp\|Q39176\|ERLI1_ARATH Lipid transfer protein EARLI 1	44.600%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card