TkA01G031060 | RubberDandelionOmics

Gene overview

TkA01G031060

Reference: TK1151 Chr: Chr01 Coordinates: 7988625-7990654 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1892 bp · TkA01G031060|TK1151|cDNA

GGAAGCTATTAGCCTAATTGCCCGACTCAAGAAATCCATTCGCTTTTTCTTTTACCTAATCCCCTTTCCCTGTTTTCCCACGCTACTCCCCCGGAAATCGACAGCGACGACTCCCTCTTCCTCTGCCGTCGCCGCCGTGCTCAGCTCAGGCACACTCACCCTCCGCGTCTCCCTCCTCTGCTTTCATCGCCGCCGTGCTCATCCCAAGATCTGGTCGCCGCCGTATCCTTCTGGTCTTTGGGAAGTCAAACCACATCAGA...

CDS

Download CDS FASTA

1185 bp · TkA01G031060|TK1151|CDS

ATGGATGCCCTATTACATCCTGTCAATGATACCCATGGTGACGACACTCTTCTTGGTTGTATAGCGAAAGACACACCCGAAGTACAGCTTCTGGAAAAATGGGCACAACTGATAAACTCCTCAAATTTCCAGCTTAGCGATATAACAACCGGATTAGCCGATCTTCTTGCTGCAAAAGAACCCAGTAAGCTCACAGATCTTAACCCCCCCGCTAATCTCCCTTCTTCTACCATGAAACAATTCGTCATTCCAAAACACGA...

Protein

Download Protein FASTA

394 aa · TkA01G031060|TK1151|PROTEIN

MDALLHPVNDTHGDDTLLGCIAKDTPEVQLLEKWAQLINSSNFQLSDITTGLADLLAAKEPSKLTDLNPPANLPSSTMKQFVIPKHEETNISDQELPESASDPEPQPKSSKKKKPNKFTAQKQGPKIWTEEEEVALTHAWISISKDDLKTIRPNPRGLWERVLEHFHTAMGMGIYRNNDAISGKWRDLKAKTTKVNDIYNNLSVKYKNEKTDFDVFNRALEKYRREKGGKPFAHLKAWEVMRNAPKWVLGTETEAETETE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G031060`
TK1151 ID	TkA01G031060
OH-1004 ID	LXL04_005605
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	94.400
Protein coverage (%)	TK1151 100.000 / OH-1004 58.074 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA01G031060`
Location	Chr01:7988625-7990654 (-)
Description	Similar to SPT16: FACT complex subunit SPT16
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_005605` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006260 DNA replication Biological Process GO:0006281 DNA repair Biological Process GO:0006337 nucleosome disassembly Biological Process GO:0006351 DNA-templated transcription Biological Process GO:0010228 vegetative to reproductive phase transition of meristem Biological Process GO:0032784 regulation of DNA-templated transcription elongation Biological Process GO:0000791 euchromatin Cellular Component GO:0005634 nucleus Cellular Component GO:0005730 nucleolus Cellular Component GO:0035101 FACT complex Cellular Component GO:0031491 nucleosome binding Molecular Function
KEGG gene cross-reference	ath:AT4G10710 dosa:Os04g0321600 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.955

Rank 1 · TkA01G031060 · TK1151

Cytoplasm0.151

Rank 2 · TkA01G031060 · TK1151

Mitochondrion0.019

Rank 3 · TkA01G031060 · TK1151

Cell membrane0.014

Rank 4 · TkA01G031060 · TK1151

Extracellular0.006

Rank 5 · TkA01G031060 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF14303NAM-associated44-135 aa

PF13837Myb_DNA-bind_4127-199 aa

PF14303NAM-associated230-386 aa

PF06785UPF0242237-364 aa

PF13837Myb_DNA-bind_4338-354 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G031060	`PF14303`	NAM-associated	44	135	0.00025	22.6
TkA01G031060	`PF13837`	Myb_DNA-bind_4	127	199	8.8e-05	23.6
TkA01G031060	`PF14303`	NAM-associated	230	386	0.00025	22.6
TkA01G031060	`PF06785`	UPF0242	237	364	3.3	8.4
TkA01G031060	`PF13837`	Myb_DNA-bind_4	338	354	8.8e-05	23.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card