RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA01G024070
Reference: TK1151 Chr: Chr01 Coordinates: 6209782-6215463 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

2168 bp · TkA01G024070|TK1151|cDNA

GTTTAATCCAAATCTGTATACTAAGCAACATCAAATAAAACTTGGATCTCAACTCTCTCTCAAGACTCACCGGAGATGAAAGAACAGTCGTCGGAAACGCGGTCTCCGGTACCACTATTGTACCGGAGACATTCAAGTGGAGATATTATGAATAATCTGGCATCAGTCTCAAGCAGTCTGTTGCCAGCTTTTGGAACTGTCGTTGGTGGTGATTCACCTCCCCTTAAAGACTATGTCATTGCACCTTATGATCGACGGTA...

CDS

Download CDS FASTA

1896 bp · TkA01G024070|TK1151|CDS

ATGAAAGAACAGTCGTCGGAAACGCGGTCTCCGGTACCACTATTGTACCGGAGACATTCAAGTGGAGATATTATGAATAATCTGGCATCAGTCTCAAGCAGTCTGTTGCCAGCTTTTGGAACTGTCGTTGGTGGTGATTCACCTCCCCTTAAAGACTATGTCATTGCACCTTATGATCGACGGTACCGGTGGTGGCAAGCATTTCTAGTGGTACTCGTTATATACTCTGCCTGGTCATCCCCGTTTGAGCTAGCTTTCAA...

Protein

Download Protein FASTA

631 aa · TkA01G024070|TK1151|PROTEIN

MKEQSSETRSPVPLLYRRHSSGDIMNNLASVSSSLLPAFGTVVGGDSPPLKDYVIAPYDRRYRWWQAFLVVLVIYSAWSSPFELAFKKVATGSLLYADLVVDFFFAADIILTFFVAYLDKSTYLLVDDHQKIATRYVTHMMFPMDVASTLPYQAIYRIFTGKLHRGEAFGFLNLLRLWRLRRVSELFSRLEKDTRFSYFATRTIKLICVTLFAVHSAGCFYYWIATHHKQSDNTWIGSIIHNFEDRSIWLGYTYSMYWSI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA01G024070
TK1151 IDTkA01G024070
OH-1004 IDLXL04_005671
Relationship / confidenceNon Reciprocal Best Hit / Complex relationship
Protein identity (%)86.000
Protein coverage (%)TK1151 100.000 / OH-1004 24.371
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA01G024070
LocationChr01:6209782-6215463 (+)
DescriptionSimilar to KAT3: Potassium channel KAT3
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At4g32650 Probable modulatory (alpha) subunit of inward-rectifying potassium channels. No verified direct reference in this release

Rice

Reference gene IDPossible functionPapers / DOI
Os01g0718700 Probable inward-rectifying potassium channel. No verified direct reference in this release
Os06g0254200 Probable inward-rectifying potassium channel. No verified direct reference in this release
UniProt: P0C550 Highly selective inward-rectifying potassium channel that mediates potassium uptake by plant roots. No verified direct reference in this release
Os01g0648000 Highly selective inward-rectifying potassium channel that mediates potassium uptake by plant roots.
Rice K+ uptake channel OsAKT1 is sensitive to salt stress.2005 · DOI: 10.1007/s00425-004-1437-9
Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_005671 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0009624 response to nematode Biological Process
GO:0071805 potassium ion transmembrane transport Biological Process
GO:0005783 endoplasmic reticulum Cellular Component
GO:0005886 plasma membrane Cellular Component
GO:0009507 chloroplast Cellular Component
GO:0034702 monoatomic ion channel complex Cellular Component
GO:0005249 voltage-gated potassium channel activity Molecular Function
KEGG gene cross-reference
ath:AT4G32650
dosa:Os01g0648000
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.648
Rank 1 · TkA01G024070 · TK1151
Cytoplasm0.172
Rank 2 · TkA01G024070 · TK1151
Endoplasmic reticulum0.127
Rank 3 · TkA01G024070 · TK1151
Lysosome / Vacuole0.089
Rank 4 · TkA01G024070 · TK1151
Golgi apparatus0.069
Rank 5 · TkA01G024070 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00520Ion_trans62-307 aa
PF00027cNMP_binding160-176 aa
PF07885Ion_trans_2237-304 aa
PF00027cNMP_binding304-323 aa
PF11834KHA313-327 aa
PF00027cNMP_binding402-485 aa
PF28642LcsF_C407-424 aa
PF28642LcsF_C480-535 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA01G024070PF00520Ion_trans623073.5e-40138.4
TkA01G024070PF00027cNMP_binding1601762.7e-1763.2
TkA01G024070PF07885Ion_trans_22373042.3e-1350.5
TkA01G024070PF00027cNMP_binding3043232.7e-1763.2
TkA01G024070PF11834KHA3133271e-2383.8
TkA01G024070PF00027cNMP_binding4024852.7e-1763.2
TkA01G024070PF28642LcsF_C4074240.1812.8
TkA01G024070PF28642LcsF_C4805350.1812.8
TkA01G024070PF11834KHA5626301e-2383.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
P92960Arabidopsis thalianasp|P92960|KAT3_ARATH Potassium channel KAT358.200%Swiss-ProtHigh
A2ZX97Oryza sativa subsp. japonicasp|A2ZX97|KAT6_ORYSJ Potassium channel KAT650.600%Swiss-ProtHigh
Q652U9Oryza sativa subsp. japonicasp|Q652U9|KAT4_ORYSJ Potassium channel KAT450.100%Swiss-ProtHigh
P0C550Oryza sativa subsp. indicasp|P0C550|AKT1_ORYSI Potassium channel AKT155.800%Swiss-ProtHigh
Q0JKV1Oryza sativa subsp. japonicasp|Q0JKV1|AKT1_ORYSJ Potassium channel AKT155.800%Swiss-ProtHigh

JBrowse

View in Genome Browser