LXL04_005671 | RubberDandelionOmics

Gene overview

LXL04_005671

Reference: OH-1004 Chr: Chr01 Coordinates: 170748255-170767204 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

7278 bp · LXL04_005671|LXL04_005671|OH1004|cDNA

ATGGGCGGGAAAATGAGTGTGAGATTGATTCTTGAGATTGATTCTTATCCTCTTTACTCTGAACAGTTCTTCACGATTACTCCGTTACACTTTGTGTTCATCGCTACCACCGCACACCTATTAGATGTTGCCGCTGCAATCAAACTAGCACCACAACCGCCACAGTTGATCTTTCATAACCATGGTTCTAAGGCGCATGGAAAAAAAGACGTTGAGAACCCATTCCCCAAGGTCGGCGCGGATTACATTCCCCGAGTCAA...

CDS

Download CDS FASTA

7278 bp · LXL04_005671|LXL04_005671|OH1004|CDS

ATGGGCGGGAAAATGAGTGTGAGATTGATTCTTGAGATTGATTCTTATCCTCTTTACTCTGAACAGTTCTTCACGATTACTCCGTTACACTTTGTGTTCATCGCTACCACCGCACACCTATTAGATGTTGCCGCTGCAATCAAACTAGCACCACAACCGCCACAGTTGATCTTTCATAACCATGGTTCTAAGGCGCATGGAAAAAAAGACGTTGAGAACCCATTCCCCAAGGTCGGCGCGGATTACATTCCCCGAGTCAA...

Protein

Download Protein FASTA

2425 aa · LXL04_005671|LXL04_005671|OH1004|PROTEIN

MGGKMSVRLILEIDSYPLYSEQFFTITPLHFVFIATTAHLLDVAAAIKLAPQPPQLIFHNHGSKAHGKKDVENPFPKVGADYIPRVNSCAMDLDGHPAGVGSGQVHYAGSAPNHAQPGPIPEPNFASSHLIFNYDNSGAMVNQWRSKIKKAGHLNSFVPPANLEVSNVQNFDLNRCAPTTSESSSNRATPTLGSLDSPTSSKDLEQTIDIGQSVGFQFDRGNAASLEVFCGGGGVKTGVCDSHKRDWMHRLRKEHRFAFC...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_005671`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_005671

Location Chr01:170748255-170767204 (-)

Description Similar to KAT3: Potassium channel KAT3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g32650`	Probable modulatory (alpha) subunit of inward-rectifying potassium channels.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os01g0718700`	Probable inward-rectifying potassium channel.	No verified direct reference in this release
`Os06g0254200`	Probable inward-rectifying potassium channel.	No verified direct reference in this release
`Os01g0648000`	Highly selective inward-rectifying potassium channel that mediates potassium uptake by plant roots.	Rice K+ uptake channel OsAKT1 is sensitive to salt stress.2005 · DOI: 10.1007/s00425-004-1437-9
`UniProt: P0C550`	Highly selective inward-rectifying potassium channel that mediates potassium uptake by plant roots.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_005671 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009624 response to nematode Biological Process

GO:0071805 potassium ion transmembrane transport Biological Process

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0034702 monoatomic ion channel complex Cellular Component

GO:0005249 voltage-gated potassium channel activity Molecular Function

KEGG gene cross-reference

ath:AT4G32650

dosa:Os01g0648000

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.471

Rank 1 · LXL04_005671 · OH-1004

Nucleus0.273

Rank 2 · LXL04_005671 · OH-1004

Cell membrane0.233

Rank 3 · LXL04_005671 · OH-1004

Endoplasmic reticulum0.062

Rank 4 · LXL04_005671 · OH-1004

Golgi apparatus0.054

Rank 5 · LXL04_005671 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00078.33RVT_1746-938 aa

PF13966.12zf-RVT1057-1129 aa

PF00520.38Ion_trans1255-1403 aa

PF00520.38Ion_trans1401-1470 aa

PF07885.23Ion_trans_21428-1468 aa

PF00027.36cNMP_binding1558-1641 aa

PF11834.14KHA1715-1782 aa

PF00078.33RVT_12323-2423 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_005671	`PF00078.33`	RVT_1	746	938	1.5e-36	126.9
LXL04_005671	`PF13966.12`	zf-RVT	1057	1129	1.1e-12	49.1
LXL04_005671	`PF00520.38`	Ion_trans	1255	1403	1.5e-18	67.6
LXL04_005671	`PF00520.38`	Ion_trans	1401	1470	1.5e-18	67.6
LXL04_005671	`PF07885.23`	Ion_trans_2	1428	1468	4.6e-06	27.1
LXL04_005671	`PF00027.36`	cNMP_binding	1558	1641	2.4e-16	60.2
LXL04_005671	`PF11834.14`	KHA	1715	1782	4.5e-21	75.3
LXL04_005671	`PF00078.33`	RVT_1	2323	2423	1.5e-36	126.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P92960`	Arabidopsis thaliana	Potassium channel KAT3	49.778%	Swiss-Prot	weak database homology
`A2ZX97`	Oryza sativa subsp. japonica	Potassium channel KAT6	41.997%	Swiss-Prot	weak database homology
`Q652U9`	Oryza sativa subsp. japonica	Potassium channel KAT4	41.905%	Swiss-Prot	weak database homology
`Q0JKV1`	Oryza sativa subsp. japonica	Potassium channel AKT1	44.181%	Swiss-Prot	weak database homology
`P0C550`	Oryza sativa subsp. indica	Potassium channel AKT1	44.181%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card