TkA01G020370 | RubberDandelionOmics

Gene overview

TkA01G020370

Reference: TK1151 Chr: Chr01 Coordinates: 5229677-5233626 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2317 bp · TkA01G020370|TK1151|cDNA

TCTACACACATTCGGAACACTTTTCCTTTTTGTTCATTTTTATATAGTTAAATAATTTTTTAGCCATTGGTATAAGCTTCAAACCATCATCCCGTAATACTGTTTCTTTCAGTGAAGAAACAACAAGACTACATCACAAACCATTCATTCACTCATTCACATTTACAAAATCAATACCCCATCTTTCACTTTTCTGATACATTCCGTCCTCTCTCTCAACCATTCGTTGCTTTCTTGGTTTTTAACTTTGGTGTTAGTGC...

CDS

Download CDS FASTA

1665 bp · TkA01G020370|TK1151|CDS

ATGCAAAGAGATTCAATTGTGAAGAACGTGCTTTATGATCTTTGTTGCTCTTATGGATGGTGTTATGGTGTTTTTTGGAGCTTTGACCGGTCAAATTCTTTATTCTTAACTATGCAAGATGCGTATTATGAGGAAAAACTGGAAGGTTTAATCGAAAATATACGTATACAAATACCTATGCTTGGAGGAGGGATAATTGGACAAGCTGCTTTCACCAAGAAGCATCAATGGAAGTCGATAGAAAACCCTAACAGAATGCA...

Protein

Download Protein FASTA

554 aa · TkA01G020370|TK1151|PROTEIN

MQRDSIVKNVLYDLCCSYGWCYGVFWSFDRSNSLFLTMQDAYYEEKLEGLIENIRIQIPMLGGGIIGQAAFTKKHQWKSIENPNRMHYSSKFISDMFMDDSEFDYQFASGIKTIAAIPVDSQGVVQFGSTEKITETGEFVYHTQKMFQEIVNAPCSSSNSQSCPPDQFACLISSNDHGCFSNFTGGDHNSAQSSFFSSNSQPMVFPNDPESRTLEPWNPIPSQFNSSLPLTNNHHDSFDSFPDFGILQTTDFDISQWIPT...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G020370`
TK1151 ID	TkA01G020370
OH-1004 ID	LXL04_026273
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	52.500
Protein coverage (%)	TK1151 99.097 / OH-1004 96.423 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G020370

Location Chr01:5229677-5233626 (+)

Description Similar to BHLH157: Transcription factor bHLH157

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g64625`	Transcription factor that may regulate root development.	No verified direct reference in this release
`At2g27230`	Transcription activator that regulates root development; promotes the production of stele cells in roots.	No verified direct reference in this release
`At1g06150`	Transcription factor that may regulate root development.	No verified direct reference in this release
`At2g31280`	Transcription factor that may regulate root development.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_026273 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0007140 male meiotic nuclear division Biological Process

GO:0010078 maintenance of root meristem identity Biological Process

GO:0010089 xylem development Biological Process

GO:0010479 stele development Biological Process

GO:0045893 positive regulation of DNA-templated transcription Biological Process

GO:0048316 seed development Biological Process

GO:0048364 root development Biological Process

GO:0051321 meiotic cell cycle Biological Process

GO:0071365 cellular response to auxin stimulus Biological Process

GO:0090058 metaxylem development Biological Process

KEGG gene cross-reference

ath:AT1G06150

ath:AT1G64625

ath:AT2G27230

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.951

Rank 1 · TkA01G020370 · TK1151

Cytoplasm0.125

Rank 2 · TkA01G020370 · TK1151

Cell membrane0.028

Rank 3 · TkA01G020370 · TK1151

Endoplasmic reticulum0.018

Rank 4 · TkA01G020370 · TK1151

Plastid0.015

Rank 5 · TkA01G020370 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF14215bHLH-MYC_N8-45 aa

PF24914ACR10_N13-34 aa

PF14215bHLH-MYC_N60-147 aa

PF23176bHLH_LHW363-421 aa

PF24914ACR10_N469-510 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G020370	`PF14215`	bHLH-MYC_N	8	45	4.1e-22	80.0
TkA01G020370	`PF24914`	ACR10_N	13	34	0.36	11.0
TkA01G020370	`PF14215`	bHLH-MYC_N	60	147	4.1e-22	80.0
TkA01G020370	`PF23176`	bHLH_LHW	363	421	1e-25	90.2
TkA01G020370	`PF24914`	ACR10_N	469	510	0.36	11.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q7XJU0`	Arabidopsis thaliana	sp\|Q7XJU0\|LHWL2_ARATH Transcription factor bHLH157	34.900%	Swiss-Prot	Medium
`Q9XIN0`	Arabidopsis thaliana	sp\|Q9XIN0\|LHW_ARATH Transcription factor LHW	55.700%	Swiss-Prot	Low
`P0C7P8`	Arabidopsis thaliana	sp\|P0C7P8\|LHWL1_ARATH Transcription factor EMB1444	45.900%	Swiss-Prot	Low
`Q58G01`	Arabidopsis thaliana	sp\|Q58G01\|LHWL3_ARATH Transcription factor bHLH155	46.900%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card