RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA01G019160
Reference: TK1151 Chr: Chr01 Coordinates: 4892608-4898191 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

1555 bp · TkA01G019160|TK1151|cDNA

GTTTCCTTCTCTCCAATTTTCATTTTCCCCCCTCATTAGTCAATTTCAACATAATTCAACAAGTTTCCACACAACTCCATGCCTCTTAACTTTCTATTTGACTTCCATTGTTTTCTTCCCCAAATTACGATTAGAAACCGCCTAAATTAATCCTTTTTCATTCTTCCGATCTGTCCTACTCTTTCAACTGTTATAAATTCAGACACTATATATCCACCCACTAAATCATCTCTCTCTCTGCTCCATAGATTCCGGCGGCT...

CDS

Download CDS FASTA

1044 bp · TkA01G019160|TK1151|CDS

ATGGCGCCGCCTTTGTGTATATTGGTGACTGGTGGTGCCGGATATATAGGGAGTCACACGGTGTTGCAGCTGTTGTTTGACGGGTATAAGGCGGTGGTGGTTGATAATCTTGATAATTCATCTGAAGTCGCTATTAGTCGAGTTCAAGAACTCGCCGGTGATCGTGCCCATAATTTATCTTTTCACAAGATGGACATCCGGGATAAGCCTGCATTAGAGCAGCTATTTGCTTCAACAAAGTTTGATGTTGTTATACATTT...

Protein

Download Protein FASTA

347 aa · TkA01G019160|TK1151|PROTEIN

MAPPLCILVTGGAGYIGSHTVLQLLFDGYKAVVVDNLDNSSEVAISRVQELAGDRAHNLSFHKMDIRDKPALEQLFASTKFDVVIHLAGLKAVGESVKKPLMYYNNNIIGTITLLEVMASYGCKKLVFSSSATVYGVPKEVPCTEEFPLSAVNPYGRTKLMIEEICRDIYTSDPEWKIILLRYFNPIGAHSSGKMGEDPHGTPNNLMPFVQQVAVGRRPKLQVFGTDYSTKDGTGVRDYIHVVDLADGHVAALRKLSDTN...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA01G019160
TK1151 IDTkA01G019160
OH-1004 IDLXL04_005751
Relationship / confidenceRbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)89.700
Protein coverage (%)TK1151 100.000 / OH-1004 100.000
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA01G019160
LocationChr01:4892608-4898191 (+)
DescriptionSimilar to UDP-glucose 4-epimerase GEPI48
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At4g10960 Catalyzes the interconversion between UDP-glucose and UDP- galactose.
Distinct properties of the five UDP-D-glucose/UDP-D-galactose 4-epimerase isoforms of Arabidopsis thaliana.2006 · DOI: 10.1074/jbc.m512727200
Bifunctional cytosolic UDP-glucose 4-epimerases catalyse the interconversion between UDP-D-xylose and UDP-L-arabinose in plants.2009 · DOI: 10.1042/bj20091025
At4g23920 Catalyzes the interconversion between UDP-glucose and UDP- galactose.
Distinct properties of the five UDP-D-glucose/UDP-D-galactose 4-epimerase isoforms of Arabidopsis thaliana.2006 · DOI: 10.1074/jbc.m512727200
UDP-glucose 4-epimerase isoforms UGE2 and UGE4 cooperate in providing UDP-galactose for cell wall biosynthesis and growth of Arabidopsis thaliana.2007 · DOI: 10.1105/tpc.106.049619
Bifunctional cytosolic UDP-glucose 4-epimerases catalyse the interconversion between UDP-D-xylose and UDP-L-arabinose in plants.2009 · DOI: 10.1042/bj20091025
At1g64440 Catalyzes the interconversion between UDP-glucose and UDP- galactose.
Galactose biosynthesis in Arabidopsis: genetic evidence for substrate channeling from UDP-D-galactose into cell wall polymers.2002 · DOI: 10.1016/s0960-9822(02)01260-5
Growth regulators and the control of nucleotide sugar flux.2004 · DOI: 10.1105/tpc.019661
The reb1-1 mutation of Arabidopsis. Effect on the structure and localization of galactose-containing cell wall polysaccharides.2006 · DOI: 10.1104/pp.105.074997
Distinct properties of the five UDP-D-glucose/UDP-D-galactose 4-epimerase isoforms of Arabidopsis thaliana.2006 · DOI: 10.1074/jbc.m512727200
UDP-glucose 4-epimerase isoforms UGE2 and UGE4 cooperate in providing UDP-galactose for cell wall biosynthesis and growth of Arabidopsis thaliana.2007 · DOI: 10.1105/tpc.106.049619
Bifunctional cytosolic UDP-glucose 4-epimerases catalyse the interconversion between UDP-D-xylose and UDP-L-arabinose in plants.2009 · DOI: 10.1042/bj20091025

Rice

Reference gene IDPossible functionPapers / DOI
Os05g0595100 Catalyzes the interconversion between UDP-glucose and UDP-galactose. No verified direct reference in this release
Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_005751 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0005996 monosaccharide metabolic process Biological Process
GO:0006012 galactose metabolic process Biological Process
GO:0009832 plant-type cell wall biogenesis Biological Process
GO:0009969 xyloglucan biosynthetic process Biological Process
GO:0010053 root epidermal cell differentiation Biological Process
GO:0042546 cell wall biogenesis Biological Process
GO:0071555 cell wall organization Biological Process
GO:0005576 extracellular region Cellular Component
GO:0005794 Golgi apparatus Cellular Component
GO:0005795 Golgi stack Cellular Component
GO:0005829 cytosol Cellular Component
GO:0003978 UDP-glucose 4-epimerase activity Molecular Function
KEGG gene cross-reference
ath:AT1G64440
ath:AT4G10960
ath:AT4G23920
dosa:Os05g0595100
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.684
Rank 1 · TkA01G019160 · TK1151
Nucleus0.246
Rank 2 · TkA01G019160 · TK1151
Peroxisome0.110
Rank 3 · TkA01G019160 · TK1151
Mitochondrion0.105
Rank 4 · TkA01G019160 · TK1151
Cell membrane0.055
Rank 5 · TkA01G019160 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00106adh_short6-94 aa
PF01370Epimerase7-269 aa
PF02719Polysacc_synt_27-189 aa
PF04321RmlD_sub_bind7-168 aa
PF08659KR7-92 aa
PF05368NmrA7-131 aa
PF16363GDP_Man_Dehyd8-331 aa
PF010733Beta_HSD8-165 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA01G019160PF00106adh_short6941.2e-0628.8
TkA01G019160PF01370Epimerase72692.5e-58198.1
TkA01G019160PF02719Polysacc_synt_271893.1e-1763.4
TkA01G019160PF04321RmlD_sub_bind71683.5e-1246.7
TkA01G019160PF08659KR7925.4e-0627.2
TkA01G019160PF05368NmrA71310.01915.3
TkA01G019160PF16363GDP_Man_Dehyd83313.6e-70237.8
TkA01G019160PF010733Beta_HSD81658.3e-1761.8
TkA01G019160PF07993NAD_binding_491686.9e-0626.1
TkA01G019160PF13460NAD_binding_10111794.7e-0524.1
TkA01G019160PF13649Methyltransf_2540930.0315.7
TkA01G019160PF13847Methyltransf_3141950.00916.5
TkA01G019160PF13649Methyltransf_252182300.0315.7
TkA01G019160PF010733Beta_HSD2282608.3e-1761.8
TkA01G019160PF13649Methyltransf_252392560.0315.7
TkA01G019160PF04321RmlD_sub_bind2422873.5e-1246.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q9SN58Arabidopsis thalianasp|Q9SN58|UGE5_ARATH UDP-glucose 4-epimerase 578.200%Swiss-ProtHigh
Q9T0A7Arabidopsis thalianasp|Q9T0A7|UGE2_ARATH UDP-glucose 4-epimerase 278.200%Swiss-ProtHigh
Q9C7W7Arabidopsis thalianasp|Q9C7W7|UGE4_ARATH UDP-glucose 4-epimerase 477.400%Swiss-ProtHigh
Q8LNZ3Oryza sativa subsp. japonicasp|Q8LNZ3|UGE1_ORYSJ UDP-glucose 4-epimerase 178.500%Swiss-ProtHigh

JBrowse

View in Genome Browser