TkA01G010130 | RubberDandelionOmics

Gene overview

TkA01G010130

Reference: TK1151 Chr: Chr01 Coordinates: 2757724-2760218 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1479 bp · TkA01G010130|TK1151|cDNA

AAATTGACAAAATATTAATCATCTTGATCTATGTTTACCGTTACAATAACAAAATCTATCACAGATTACCAGGTCACCAAACATAAAGTAGACAGACAAGCAACCGCATATCTCCACCGTTTTCTTTGATTCCCGGCGACTATATTGGTAGCAACACCGCTTTCCCTCTCCATACATCCCTTCCAAGTTACTTCCCAAATAAACCCTACATATACACATACACCCACCTATCCCACATCGATTCGAAGAAAAGAAATCGC...

CDS

Download CDS FASTA

1008 bp · TkA01G010130|TK1151|CDS

ATGGGTAACAGAGATCTAGAGAGCAGAGGAAGCTCGAAGAACAGAGGTGCACCACCGGCGCCGCCGCCGCACTCCAATTATTACACATCGTCTTCACCGTACTACGCAGAATCATTGGAGAAACAATGGACTTCTTGGCTTGTTCCTATGATTGTTGTTGCGAATGTGGCTATGTTTATTGTCATCATGATTGTTAACGATTGCCCTAAGAACCACAATTCGAGTCTCGAGGGGAAGTGCGTTGCTAGGTTTTTAGGTAG...

Protein

Download Protein FASTA

335 aa · TkA01G010130|TK1151|PROTEIN

MGNRDLESRGSSKNRGAPPAPPPHSNYYTSSSPYYAESLEKQWTSWLVPMIVVANVAMFIVIMIVNDCPKNHNSSLEGKCVARFLGRLSFQPLKENPLFGPSSSTLEKLGALEWKKVVNNNQAWRLVSCIWLHAGVIHVLANMLSLIFIGIRLEQQFGFARVGVIYMLSGIGGSILSTLFIKSNISVGASGALFGLLGAMLSELLTNWTIYANKAAALITLVIIILINLAVGILPHVDNFAHIGGFLTGFLLGFILLVRP...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G010130`
TK1151 ID	TkA01G010130
OH-1004 ID	LXL04_005878
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	98.500
Protein coverage (%)	TK1151 99.104 / OH-1004 95.402 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G010130

Location Chr01:2757724-2760218 (+)

Description Similar to RBL3: RHOMBOID-like protein 3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g07250`	Probable rhomboid-type serine protease that catalyzes intramembrane proteolysis.	No verified direct reference in this release
`At1g63120`	Rhomboid-type serine protease that catalyzes intramembrane proteolysis.	An Arabidopsis Rhomboid homolog is an intramembrane protease in plants.2005 · DOI: 10.1016/j.febslet.2005.09.049
`At2g29050`	Probable rhomboid-type serine protease that catalyzes intramembrane proteolysis.	No verified direct reference in this release
`At1g12750`	Probable rhomboid-type serine protease that catalyzes intramembrane proteolysis.	No verified direct reference in this release
`At3g53780`	Probable rhomboid-type serine protease that catalyzes intramembrane proteolysis.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_005878 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006508 proteolysis Biological Process

GO:0000139 Golgi membrane Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0016020 membrane Cellular Component

GO:0031966 mitochondrial membrane Cellular Component

GO:0004252 serine-type endopeptidase activity Molecular Function

KEGG gene cross-reference

ath:AT1G12750

ath:AT1G63120

ath:AT2G29050

ath:AT3G53780

ath:AT5G07250

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Lysosome / Vacuole0.347

Rank 1 · TkA01G010130 · TK1151

Golgi apparatus0.346

Rank 2 · TkA01G010130 · TK1151

Cytoplasm0.257

Rank 3 · TkA01G010130 · TK1151

Cell membrane0.152

Rank 4 · TkA01G010130 · TK1151

Endoplasmic reticulum0.135

Rank 5 · TkA01G010130 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF16101PRIMA117-68 aa

PF22812CR_prot_dom_plant18-68 aa

PF03918CcmH41-67 aa

PF01694Rhomboid42-63 aa

PF27171YxeC53-67 aa

PF01694Rhomboid121-257 aa

PF27171YxeC122-171 aa

PF16101PRIMA1214-227 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G010130	`PF16101`	PRIMA1	17	68	0.25	11.8
TkA01G010130	`PF22812`	CR_prot_dom_plant	18	68	0.0063	17.6
TkA01G010130	`PF03918`	CcmH	41	67	0.13	12.3
TkA01G010130	`PF01694`	Rhomboid	42	63	3.8e-43	147.8
TkA01G010130	`PF27171`	YxeC	53	67	0.41	11.3
TkA01G010130	`PF01694`	Rhomboid	121	257	3.8e-43	147.8
TkA01G010130	`PF27171`	YxeC	122	171	0.41	11.3
TkA01G010130	`PF16101`	PRIMA1	214	227	0.25	11.8
TkA01G010130	`PF22812`	CR_prot_dom_plant	217	228	0.0063	17.6
TkA01G010130	`PF03918`	CcmH	279	309	0.13	12.3
TkA01G010130	`PF27171`	YxeC	290	293	0.41	11.3
TkA01G010130	`PF01694`	Rhomboid	296	304	3.8e-43	147.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LYP1`	Arabidopsis thaliana	sp\|Q9LYP1\|RBL3_ARATH RHOMBOID-like protein 3	64.600%	Swiss-Prot	High
`Q9CAN1`	Arabidopsis thaliana	sp\|Q9CAN1\|RBL2_ARATH RHOMBOID-like protein 2	65.700%	Swiss-Prot	High
`Q0WQX7`	Arabidopsis thaliana	sp\|Q0WQX7\|RBL1_ARATH RHOMBOID-like protein 1	65.400%	Swiss-Prot	High
`Q8VZ48`	Arabidopsis thaliana	sp\|Q8VZ48\|RBL6_ARATH RHOMBOID-like protein 6, mitochondrial	62.600%	Swiss-Prot	High
`F4JBM4`	Arabidopsis thaliana	sp\|F4JBM4\|RBL4_ARATH RHOMBOID-like protein 4	58.400%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card