LXL04_038966 | RubberDandelionOmics

Gene overview

LXL04_038966

Reference: OH-1004 Chr: Chr09 Coordinates: 55164543-55167318 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1305 bp · LXL04_038966|LXL04_038966|OH1004|cDNA

ATGAAAGGTGAACACATATGCTGTAGCAAAGGAGAAGTCAAGAAAGGGCCATGGTCGGCTGAAGAAGATAAATTACTTTTTAATTACGTTACAAATCATGACCAATTTCATTGGAGCTCCGTTCCCGAACAAAGtgGGTTGAAAAGATGTGGGAAGAGTTGCCGATTGAGATGGCTCAATTATTTGCACCCAGATCTTAAGCATGGAAATTTCAGTGCAGAAGAAATAGATCTTATATTTAGGGTTCAAAAGGATATCGG...

CDS

Download CDS FASTA

1305 bp · LXL04_038966|LXL04_038966|OH1004|CDS

ATGAAAGGTGAACACATATGCTGTAGCAAAGGAGAAGTCAAGAAAGGGCCATGGTCGGCTGAAGAAGATAAATTACTTTTTAATTACGTTACAAATCATGACCAATTTCATTGGAGCTCCGTTCCCGAACAAAGTGGGTTGAAAAGATGTGGGAAGAGTTGCCGATTGAGATGGCTCAATTATTTGCACCCAGATCTTAAGCATGGAAATTTCAGTGCAGAAGAAATAGATCTTATATTTAGGGTTCAAAAGGATATCGG...

Protein

Download Protein FASTA

434 aa · LXL04_038966|LXL04_038966|OH1004|PROTEIN

MKGEHICCSKGEVKKGPWSAEEDKLLFNYVTNHDQFHWSSVPEQSGLKRCGKSCRLRWLNYLHPDLKHGNFSAEEIDLIFRVQKDIGNKWAEIARLLPGRTDNEIKNFWNSKMKKRPLSNKQCYGLCSSTQHYKFSTPVPIHPISILESSNQPHNHRTSTTFNQSANIDSSKFLLENPHNSIIGNGSFQSKSVMKIHPYIDNNLNQRSPLKQLYTIPSPSCCIFPMLKTSSISNYGGIKRNQSKDHQPFSSLIPNTFPIP...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_038966`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_038966

Location Chr09:55164543-55167318 (-)

Description Similar to MYB86: Transcription factor MYB86

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g26660`	Probable transcription factor.	No verified direct reference in this release
`At1g09540`	Transcription factor that coordinates a small network of downstream target genes required for several aspects of plant growth and development, such as xylem formation and xylem cell differentiation, and lateral root formation.	AtMYB61, an R2R3-MYB transcription factor controlling stomatal aperture in Arabidopsis thaliana.2005 · DOI: 10.1016/j.cub.2005.06.041 MUM ENHANCERS are important for seed coat mucilage production and mucilage secretory cell differentiation in Arabidopsis thaliana.2009 · DOI: 10.1093/jxb/erp102 AtMYB61, an R2R3-MYB transcription factor, functions as a pleiotropic regulator via a small gene network.2012 · DOI: 10.1111/j.1469-8137.2012.04201.x Interactions between the R2R3-MYB transcription factor, AtMYB61, and target DNA binding sites.2013 · DOI: 10.1371/journal.pone.0065132 AaMYB1 and its orthologue AtMYB61 affect terpene metabolism and trichome development in Artemisia annua and Arabidopsis thaliana.2017 · DOI: 10.1111/tpj.13509
`At3g13890`	Probable transcription factor that regulates lignified secondary cell wall thickening of the anther endocethium, which is necessary for anther dehiscence.	Disruption of Arabidopsis thaliana MYB26 results in male sterility due to non-dehiscent anthers.2003 · DOI: 10.1046/j.1365-313x.2003.01745.x Efficient production of male and female sterile plants by expression of a chimeric repressor in Arabidopsis and rice.2006 · DOI: 10.1111/j.1467-7652.2006.00184.x Arabidopsis MYB26/MALE STERILE35 regulates secondary thickening in the endothecium and is essential for anther dehiscence.2007 · DOI: 10.1105/tpc.106.046391
`At1g22640`	Transcription factor MYB3.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_038966 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0009611 response to wounding Biological Process

GO:0009800 cinnamic acid biosynthetic process Biological Process

GO:0009813 flavonoid biosynthetic process Biological Process

GO:0009834 plant-type secondary cell wall biogenesis Biological Process

GO:0009892 negative regulation of metabolic process Biological Process

GO:0010087 phloem or xylem histogenesis Biological Process

GO:0010089 xylem development Biological Process

GO:0010119 regulation of stomatal movement Biological Process

GO:0010214 seed coat development Biological Process

GO:0045892 negative regulation of DNA-templated transcription Biological Process

KEGG gene cross-reference

ath:AT1G09540

ath:AT1G22640

ath:AT3G13890

ath:AT5G26660

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.865

Rank 1 · LXL04_038966 · OH-1004

Cytoplasm0.211

Rank 2 · LXL04_038966 · OH-1004

Cell membrane0.020

Rank 3 · LXL04_038966 · OH-1004

Mitochondrion0.020

Rank 4 · LXL04_038966 · OH-1004

Lysosome / Vacuole0.010

Rank 5 · LXL04_038966 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00249.38Myb_DNA-binding15-62 aa

PF13921.13Myb_DNA-bind_618-77 aa

PF00249.38Myb_DNA-binding69-111 aa

PF13921.13Myb_DNA-bind_671-114 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_038966	`PF00249.38`	Myb_DNA-binding	15	62	1.2e-28	99.6
LXL04_038966	`PF13921.13`	Myb_DNA-bind_6	18	77	2.2e-17	63.7
LXL04_038966	`PF00249.38`	Myb_DNA-binding	69	111	1.2e-28	99.6
LXL04_038966	`PF13921.13`	Myb_DNA-bind_6	71	114	2.2e-17	63.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8LPH6`	Arabidopsis thaliana	Transcription factor MYB86	60.526%	Swiss-Prot	weak database homology
`Q8VZQ2`	Arabidopsis thaliana	Transcription factor MYB61	59.649%	Swiss-Prot	weak database homology
`Q9SPG3`	Arabidopsis thaliana	Transcription factor MYB26	54.762%	Swiss-Prot	weak database homology
`Q9S9K9`	Arabidopsis thaliana	Transcription factor MYB3	55.556%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card