LXL04_038870 | RubberDandelionOmics

Gene overview

LXL04_038870

Reference: OH-1004 Chr: Chr09 Coordinates: 52246252-52247203 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

735 bp · LXL04_038870|LXL04_038870|OH1004|cDNA

ATGGTTAGGGTTCTTTCCCCTTCCATCTTCCATTCTCAGCCGTCCGATGATCATCGATTTCCCACTCCTTTTTTCTCCCACTATTTAATTCTCCACGTTACTCTGTCACTGTCGGTTCTTTTATATGGTAGCGCCAGCACTTACACCGCCGTCATTCTTATCACTCTCACGTATTCCAATATTTCCAGCTTCCTGTTTTCACTCCTCTGCTCCAAACTCACTCATTCCAATTTTCAAGTTCAGGAAGCGGTTCGGGTTCT...

CDS

Download CDS FASTA

735 bp · LXL04_038870|LXL04_038870|OH1004|CDS

ATGGTTAGGGTTCTTTCCCCTTCCATCTTCCATTCTCAGCCGTCCGATGATCATCGATTTCCCACTCCTTTTTTCTCCCACTATTTAATTCTCCACGTTACTCTGTCACTGTCGGTTCTTTTATATGGTAGCGCCAGCACTTACACCGCCGTCATTCTTATCACTCTCACGTATTCCAATATTTCCAGCTTCCTGTTTTCACTCCTCTGCTCCAAACTCACTCATTCCAATTTTCAAGTTCAGGAAGCGGTTCGGGTTCT...

Protein

Download Protein FASTA

244 aa · LXL04_038870|LXL04_038870|OH1004|PROTEIN

MVRVLSPSIFHSQPSDDHRFPTPFFSHYLILHVTLSLSVLLYGSASTYTAVILITLTYSNISSFLFSLLCSKLTHSNFQVQEAVRVLISAGETKESVCSEETIGTNEKLCVDCKTSKTPLWRSGPAGPKTLCNACGIRYRKKKSPIGSDKKVEKQPPSPASSPSSSSCSTSAAACTDEDAGMRKKLRINLVAVGKEVVVLQRRRSRMMKKVKGENIEKEYRKLGEVEEAAFLLISLSCGGAVFG

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_038870`
TK1151 ID	TkA04G472730
OH-1004 ID	LXL04_038870
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 47.802 / OH-1004 35.656 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_038870

Location Chr09:52246252-52247203 (-)

Description Similar to GATA15: GATA transcription factor 15

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g06740`	Transcriptional regulator that specifically binds 5'-GATA-3' or 5'-GAT-3' motifs within gene promoters.	No verified direct reference in this release
`At5g49300`	Transcriptional regulator that specifically binds 5'-GATA-3' or 5'-GAT-3' motifs within gene promoters.	No verified direct reference in this release
`At3g16870`	Transcriptional regulator that specifically binds 5'-GATA-3' or 5'-GAT-3' motifs within gene promoters.	No verified direct reference in this release
`At5g25830`	Transcriptional activator that specifically binds 5'-GATA-3' or 5'-GAT-3' motifs within gene promoters.	No verified direct reference in this release
`At5g26930`	Transcriptional regulator that specifically binds 5'-GATA-3' or 5'-GAT-3' motifs within gene promoters.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_038870 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0006357 regulation of transcription by RNA polymerase II Biological Process

GO:0007623 circadian rhythm Biological Process

GO:0009416 response to light stimulus Biological Process

GO:0030154 cell differentiation Biological Process

GO:0045893 positive regulation of DNA-templated transcription Biological Process

GO:0048527 lateral root development Biological Process

GO:0071555 cell wall organization Biological Process

GO:1905177 tracheary element differentiation Biological Process

GO:0005634 nucleus Cellular Component

GO:0000976 transcription cis-regulatory region binding Molecular Function

KEGG gene cross-reference

ath:AT3G06740

ath:AT3G16870

ath:AT5G25830

ath:AT5G26930

ath:AT5G49300

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.951

Rank 1 · LXL04_038870 · OH-1004

Cytoplasm0.115

Rank 2 · LXL04_038870 · OH-1004

Cell membrane0.032

Rank 3 · LXL04_038870 · OH-1004

Endoplasmic reticulum0.024

Rank 4 · LXL04_038870 · OH-1004

Plastid0.013

Rank 5 · LXL04_038870 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00320.34GATA110-144 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_038870	`PF00320.34`	GATA	110	144	1.5e-17	63.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8LG10`	Arabidopsis thaliana	GATA transcription factor 15	38.194%	Swiss-Prot	moderate database homology
`Q9FJ10`	Arabidopsis thaliana	GATA transcription factor 16	37.410%	Swiss-Prot	moderate database homology
`Q9LIB5`	Arabidopsis thaliana	GATA transcription factor 17	36.774%	Swiss-Prot	moderate database homology
`P69781`	Arabidopsis thaliana	GATA transcription factor 12	59.574%	Swiss-Prot	weak database homology
`Q8LC59`	Arabidopsis thaliana	GATA transcription factor 23	54.237%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card