LXL04_037813 | RubberDandelionOmics

Gene overview

LXL04_037813

Reference: OH-1004 Chr: Chr09 Coordinates: 21908392-21909334 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

597 bp · LXL04_037813|LXL04_037813|OH1004|cDNA

ATGGCTTCCCATTCCTTAACTCCCAGCAATTTCAGACTCCAACTTCTCATTTCATCGAAACCCCAATTAAACTCAATCCTCAAATCATCTAATCGGTTTCAATTAAGCATACCCACAGCCAGATTTTCTTCATCGATTCGCTCTATGGGttcttcgtcttcttcatcTCAGAAACCAGACGCCTCAACTCAAGAGGCTGGAAAGATGGATTATAAATCTGTTAGCGAGCAAGAATGGAAGAAGAAGCTTAGTGGAGAACA...

CDS

Download CDS FASTA

597 bp · LXL04_037813|LXL04_037813|OH1004|CDS

ATGGCTTCCCATTCCTTAACTCCCAGCAATTTCAGACTCCAACTTCTCATTTCATCGAAACCCCAATTAAACTCAATCCTCAAATCATCTAATCGGTTTCAATTAAGCATACCCACAGCCAGATTTTCTTCATCGATTCGCTCTATGGGTTCTTCGTCTTCTTCATCTCAGAAACCAGACGCCTCAACTCAAGAGGCTGGAAAGATGGATTATAAATCTGTTAGCGAGCAAGAATGGAAGAAGAAGCTTAGTGGAGAACA...

Protein

Download Protein FASTA

198 aa · LXL04_037813|LXL04_037813|OH1004|PROTEIN

MASHSLTPSNFRLQLLISSKPQLNSILKSSNRFQLSIPTARFSSSIRSMGSSSSSSQKPDASTQEAGKMDYKSVSEQEWKKKLSGEQFYVTRQKGTERAFSGEYWNSKTPGTYHCICCDTPLFESSTKFDSGTGWPSYYQPIGNNVKSKLDLSIIFMPRQEVVCAACDAHLGHVFDDGPPPTGKRYCINSASLKLNPK

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_037813`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_037813

Location Chr09:21908392-21909334 (+)

Description Similar to MSRB1: Peptide methionine sulfoxide reductase B1, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g53670`	Catalyzes the reduction of methionine sulfoxide (MetSO) to methionine in proteins.	The Arabidopsis plastidic methionine sulfoxide reductase B proteins. Sequence and activity characteristics, comparison of the expression with plastidic methionine sulfoxide reductase A, and induction by photooxidative stress.2005 · DOI: 10.1104/pp.105.062430 Specificity of thioredoxins and glutaredoxins as electron donors to two distinct classes of Arabidopsis plastidial methionine sulfoxide reductases B.2007 · DOI: 10.1016/j.febslet.2007.07.081 Regeneration mechanisms of Arabidopsis thaliana methionine sulfoxide reductases B by glutaredoxins and thioredoxins.2009 · DOI: 10.1074/jbc.m109.015487 Arabidopsis thaliana plastidial methionine sulfoxide reductases B, MSRBs, account for most leaf peptide MSR activity and are essential for growth under environmental constraints through a role in the preservation of photosystem antennae.2010 · DOI: 10.1111/j.1365-313x.2009.04053.x Plant thioredoxin CDSP32 regenerates 1-cys methionine sulfoxide reductase B activity through the direct reduction of sulfenic acid.2010 · DOI: 10.1074/jbc.m110.108373

Rice

Reference gene ID	Possible function	Papers / DOI
`Os06g0472000`	Catalyzes the reduction of methionine sulfoxide (MetSO) to methionine in proteins.	OsMSRA4.1 and OsMSRB1.1, two rice plastidial methionine sulfoxide reductases, are involved in abiotic stress responses.2009 · DOI: 10.1007/s00425-009-0934-2

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_037813 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006979 response to oxidative stress Biological Process

GO:0030091 protein repair Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009570 chloroplast stroma Cellular Component

GO:0008270 zinc ion binding Molecular Function

GO:0033743 peptide-methionine (R)-S-oxide reductase activity Molecular Function

GO:0046872 metal ion binding Molecular Function

KEGG gene cross-reference

amr:AM1_2115

ath:AT1G53670

avn:Avin_15440

dosa:Os06g0472000

tel:tlr1214

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.693

Rank 1 · LXL04_037813 · OH-1004

Mitochondrion0.318

Rank 2 · LXL04_037813 · OH-1004

Cytoplasm0.084

Rank 3 · LXL04_037813 · OH-1004

Nucleus0.069

Rank 4 · LXL04_037813 · OH-1004

Peroxisome0.020

Rank 5 · LXL04_037813 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01641.27SelR83-196 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_037813	`PF01641.27`	SelR	83	196	2.7e-49	166.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9C8M2`	Arabidopsis thaliana	Peptide methionine sulfoxide reductase B1, chloroplastic	81.295%	Swiss-Prot	strong database homology
`Q0DC89`	Oryza sativa subsp. japonica	Peptide methionine sulfoxide reductase B1, chloroplastic	82.114%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card