LXL04_037609 | RubberDandelionOmics

Gene overview

LXL04_037609

Reference: OH-1004 Chr: Chr09 Coordinates: 15773229-15774116 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

888 bp · LXL04_037609|LXL04_037609|OH1004|cDNA

ATGGGGAAAGCAGGAAGAGATTGGACACAGATCTATGCAATATACGGCATGGACGATTGGCACACACCGATTTTTCTCCTGATCCACGCAATCGTCTTCTCGGCTTCATCACTCGTATTCCTTCTATACTTCAACTGGATTTGCTACTCTTTCGAATCAATCTTCCCGTCAGTATTTTCCGGCAGTTTCGCCAGATTTGCCGCAGGATTCACCGGCTCCGTTACCGCTCTCTCCGCCGTCTGCCTCTTCTACGCCGCCGG...

CDS

Download CDS FASTA

888 bp · LXL04_037609|LXL04_037609|OH1004|CDS

ATGGGGAAAGCAGGAAGAGATTGGACACAGATCTATGCAATATACGGCATGGACGATTGGCACACACCGATTTTTCTCCTGATCCACGCAATCGTCTTCTCGGCTTCATCACTCGTATTCCTTCTATACTTCAACTGGATTTGCTACTCTTTCGAATCAATCTTCCCGTCAGTATTTTCCGGCAGTTTCGCCAGATTTGCCGCAGGATTCACCGGCTCCGTTACCGCTCTCTCCGCCGTCTGCCTCTTCTACGCCGCCGG...

Protein

Download Protein FASTA

295 aa · LXL04_037609|LXL04_037609|OH1004|PROTEIN

MGKAGRDWTQIYAIYGMDDWHTPIFLLIHAIVFSASSLVFLLYFNWICYSFESIFPSVFSGSFARFAAGFTGSVTALSAVCLFYAAGNMFYSSIALRWDMAQRMVNAVHDWSTVKTVLDVGCGRGILLNAVAMQLKKEGSSGRVVGLDRKNTTLSTLRTAGMEGVEEYVTCREGDARRLPFPENYFDVVVSAGFVHKVGKEFGPKTAAASAERMRVVGEVVRVLKEGGVGVVWDLVHVPEYVLRLQELKMEEIRVSERVT...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_037609`
TK1151 ID	TkA04G328970
OH-1004 ID	LXL04_037609
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`LXL04_037609`
Location	Chr09:15773229-15774116 (+)
Description	Protein of unknown function
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_037609` · GCA_047496595.1_OSU_TarKok_2.0.
GO annotations (OH1004 source)	GO:0006400 tRNA modification Biological Process GO:0009234 menaquinone biosynthetic process Biological Process GO:0032259 methylation Biological Process GO:0046685 response to arsenic-containing substance Biological Process GO:0008175 tRNA methyltransferase activity Molecular Function GO:0008757 S-adenosylmethionine-dependent methyltransferase activity Molecular Function GO:0030791 arsenite methyltransferase activity Molecular Function GO:0043770 demethylmenaquinone methyltransferase activity Molecular Function
KEGG gene cross-reference	ecu:ECU09_1500 ljo:LJ_0053 sth:STH2515 tth:TT_C1503 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.344

Rank 1 · LXL04_037609 · OH-1004

Mitochondrion0.269

Rank 2 · LXL04_037609 · OH-1004

Nucleus0.127

Rank 3 · LXL04_037609 · OH-1004

Cytoplasm0.122

Rank 4 · LXL04_037609 · OH-1004

Peroxisome0.086

Rank 5 · LXL04_037609 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01209.25Ubie_methyltran104-238 aa

PF13847.13Methyltransf_31115-248 aa

PF13649.13Methyltransf_25117-228 aa

PF08241.19Methyltransf_11118-230 aa

PF08242.19Methyltransf_12118-229 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_037609	`PF01209.25`	Ubie_methyltran	104	238	3.4e-06	27.3
LXL04_037609	`PF13847.13`	Methyltransf_31	115	248	9.8e-13	48.8
LXL04_037609	`PF13649.13`	Methyltransf_25	117	228	3.8e-14	53.9
LXL04_037609	`PF08241.19`	Methyltransf_11	118	230	9.6e-16	58.9
LXL04_037609	`PF08242.19`	Methyltransf_12	118	229	1.9e-06	29.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card