LXL04_036663 | RubberDandelionOmics

Gene overview

LXL04_036663

Reference: OH-1004 Chr: Chr08 Coordinates: 46377002-46381055 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2271 bp · LXL04_036663|LXL04_036663|OH1004|cDNA

ATGCAATCAACGATGGCCACAAGGTGCATTAGGGCTCGTGAACTCATTCTTCGGACTACAACCAACAAGATGATGATGAGTTCGAGCCACAGCTGCAGTAGCAGTAGCATTTCTCGTTCACTCCTCCCTCAAACTTTCATCACTGGTTCACAGAGTTTCAGTAATCGTGTTTTAGTCAGACAGCTCGCCCTCCAACCACGAAGTTCATGGGGCGGTTCAAGGAACTCTCCGCACTTTTTCCGACAATTAACTGCGTTTGT...

CDS

Download CDS FASTA

2271 bp · LXL04_036663|LXL04_036663|OH1004|CDS

ATGCAATCAACGATGGCCACAAGGTGCATTAGGGCTCGTGAACTCATTCTTCGGACTACAACCAACAAGATGATGATGAGTTCGAGCCACAGCTGCAGTAGCAGTAGCATTTCTCGTTCACTCCTCCCTCAAACTTTCATCACTGGTTCACAGAGTTTCAGTAATCGTGTTTTAGTCAGACAGCTCGCCCTCCAACCACGAAGTTCATGGGGCGGTTCAAGGAACTCTCCGCACTTTTTCCGACAATTAACTGCGTTTGT...

Protein

Download Protein FASTA

756 aa · LXL04_036663|LXL04_036663|OH1004|PROTEIN

MQSTMATRCIRARELILRTTTNKMMMSSSHSCSSSSISRSLLPQTFITGSQSFSNRVLVRQLALQPRSSWGGSRNSPHFFRQLTAFVSDFSSVPPQKPGSVSNGVASLTTSTEAEGPKHKKEDDEKNLTTKGDEISNTKILSTLAKILWMKDNMEFKLRVLTALGFLVGAKVLNVQVPFLFKLAVDWLTTASGNPSTISEFAASNPTALAVFVSPAAVLIGYGIARTGASAFNELRTAVFSKVALRTIRSVSRKVFAHLH...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_036663`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_036663

Location Chr08:46377002-46381055 (-)

Description Similar to ABCB25: ABC transporter B family member 25, mitochondrial

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g58270`	Performs an essential function in the generation of cytoplasmic iron-sulfur proteins by mediating export of Fe/S cluster precursors synthesized by NFS1 and other mitochondrial proteins.	An allelic mutant series of ATM3 reveals its key role in the biogenesis of cytosolic iron-sulfur proteins in Arabidopsis.2009 · DOI: 10.1104/pp.109.143651 A novel role for Arabidopsis mitochondrial ABC transporter ATM3 in molybdenum cofactor biosynthesis.2010 · DOI: 10.1105/tpc.109.068478
`At4g28630`	Performs an essential function in the generation of cytoplasmic iron-sulfur proteins by mediating export of Fe/S cluster precursors synthesized by NFS1 and other mitochondrial proteins.	A mutation of the mitochondrial ABC transporter Sta1 leads to dwarfism and chlorosis in the Arabidopsis mutant starik.2001 · DOI: 10.1105/tpc.13.1.89
`At4g28620`	Performs an essential function in the generation of cytoplasmic iron-sulfur proteins by mediating export of Fe/S cluster precursors synthesized by NFS1 and other mitochondrial proteins (By similarity).	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_036663 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006777 Mo-molybdopterin cofactor biosynthetic process Biological Process

GO:0006826 iron ion transport Biological Process

GO:0006879 intracellular iron ion homeostasis Biological Process

GO:0009555 pollen development Biological Process

GO:0009658 chloroplast organization Biological Process

GO:0010288 response to lead ion Biological Process

GO:0010312 detoxification of zinc ion Biological Process

GO:0010380 regulation of chlorophyll biosynthetic process Biological Process

GO:0016226 iron-sulfur cluster assembly Biological Process

GO:0046686 response to cadmium ion Biological Process

GO:0048364 root development Biological Process

GO:0051276 chromosome organization Biological Process

KEGG gene cross-reference

ath:AT4G28620

ath:AT4G28630

ath:AT5G58270

dre:566515

ola:101168300

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.905

Rank 1 · LXL04_036663 · OH-1004

Plastid0.057

Rank 2 · LXL04_036663 · OH-1004

Cytoplasm0.054

Rank 3 · LXL04_036663 · OH-1004

Nucleus0.033

Rank 4 · LXL04_036663 · OH-1004

Cell membrane0.026

Rank 5 · LXL04_036663 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00664.29ABC_membrane163-449 aa

PF00005.34ABC_tran512-661 aa

PF02463.26SMC_N524-705 aa

PF13401.13AAA_22524-684 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_036663	`PF00664.29`	ABC_membrane	163	449	7.7e-37	128.2
LXL04_036663	`PF00005.34`	ABC_tran	512	661	7.8e-33	114.7
LXL04_036663	`PF02463.26`	SMC_N	524	705	1.2e-08	35.4
LXL04_036663	`PF13401.13`	AAA_22	524	684	9.9e-06	26.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LVM1`	Arabidopsis thaliana	ABC transporter B family member 25, mitochondrial	80.193%	Swiss-Prot	strong database homology
`Q9FUT3`	Arabidopsis thaliana	ABC transporter B family member 23, mitochondrial	70.165%	Swiss-Prot	strong database homology
`Q9M0G9`	Arabidopsis thaliana	ABC transporter B family member 24, mitochondrial	67.368%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card