LXL04_036176 | RubberDandelionOmics

Gene overview

LXL04_036176

Reference: OH-1004 Chr: Chr08 Coordinates: 37549281-37551501 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

981 bp · LXL04_036176|LXL04_036176|OH1004|cDNA

ATGAACGGAAGCTGTTTACAGTTGGAAGAAAATCCAATTGAAGATGCTATTTCCAGAATTCGTTTTGCCCCGGCTTCCAACAATCTCCTCATCTCTTCCTGGGATACTAATCTTAGATTGTACGATGTGGATAGATCTAGGTTAATTTTTGAAGCTTCCGGGGAAGCTGCACTTCTAGACTGCTGTTTCCAAGGGGAATCAGCTGCCTTCAGTGCCGCTTCTGATTGTTCCATAACTAGATATGATTTACATTTAGGGAC...

CDS

Download CDS FASTA

981 bp · LXL04_036176|LXL04_036176|OH1004|CDS

ATGAACGGAAGCTGTTTACAGTTGGAAGAAAATCCAATTGAAGATGCTATTTCCAGAATTCGTTTTGCCCCGGCTTCCAACAATCTCCTCATCTCTTCCTGGGATACTAATCTTAGATTGTACGATGTGGATAGATCTAGGTTAATTTTTGAAGCTTCCGGGGAAGCTGCACTTCTAGACTGCTGTTTCCAAGGGGAATCAGCTGCCTTCAGTGCCGCTTCTGATTGTTCCATAACTAGATATGATTTACATTTAGGGAC...

Protein

Download Protein FASTA

326 aa · LXL04_036176|LXL04_036176|OH1004|PROTEIN

MNGSCLQLEENPIEDAISRIRFAPASNNLLISSWDTNLRLYDVDRSRLIFEASGEAALLDCCFQGESAAFSAASDCSITRYDLHLGTKDFFGNHDDLATCVEYSDETGQIVSGGWDKKIKCWDSRSTKGLTCVNSVSVGVKSISLSGFTAMVAVGVSVKMYDLRKFNKSVDSKCVEIQIECIRPYLNQGFAAGSTDGRVALKYFNPSSQNTNGYAFRCQPKSKEKRDYFAAVNDIVFSPSNFGDFVTGDNKGFVTIWNAQ...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_036176`
TK1151 ID	TkA04G067470
OH-1004 ID	LXL04_036176
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.400
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_036176

Location Chr08:37549281-37551501 (-)

Description Similar to BUB3.3: Mitotic checkpoint protein BUB3.3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g69400`	Has a dual function in spindle-assembly checkpoint signaling and in promoting the establishment of correct kinetochore-microtubule (K-MT) attachments.	No verified direct reference in this release
`At3g19590`	Has a dual function in spindle-assembly checkpoint signaling and in promoting the establishment of correct kinetochore-microtubule (K-MT) attachments.	The Arabidopsis checkpoint protein Bub3.1 is essential for gametophyte development.2008 · DOI: 10.2741/3076 Spindle assembly checkpoint protein dynamics reveal conserved and unsuspected roles in plant cell division.2009 · DOI: 10.1371/journal.pone.0006757
`At1g49910`	Has a dual function in spindle-assembly checkpoint signaling and in promoting the establishment of correct kinetochore-microtubule (K-MT) attachments.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_036176 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0007059 chromosome segregation Biological Process

GO:0007094 mitotic spindle assembly checkpoint signaling Biological Process

GO:0051301 cell division Biological Process

GO:0051321 meiotic cell cycle Biological Process

GO:0051983 regulation of chromosome segregation Biological Process

GO:0000776 kinetochore Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005654 nucleoplasm Cellular Component

GO:0005819 spindle Cellular Component

GO:0005828 kinetochore microtubule Cellular Component

GO:0005876 spindle microtubule Cellular Component

GO:0009524 phragmoplast Cellular Component

KEGG gene cross-reference

ath:AT1G49910

ath:AT1G69400

ath:AT3G19590

ddi:DDB_G0292134

pon:100172494

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.637

Rank 1 · LXL04_036176 · OH-1004

Cytoplasm0.391

Rank 2 · LXL04_036176 · OH-1004

Lysosome / Vacuole0.047

Rank 3 · LXL04_036176 · OH-1004

Cell membrane0.043

Rank 4 · LXL04_036176 · OH-1004

Mitochondrion0.027

Rank 5 · LXL04_036176 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF24807.2WD40_CDC20-Fz8-148 aa

PF24796.2WDR5513-201 aa

PF25172.2Beta-prop_WDR3_2nd13-159 aa

PF25175.2Beta-prop_WDR514-153 aa

PF24814.2WD40_Prp1914-168 aa

PF23381.2Beta-prop_IFT122_1st59-292 aa

PF25173.2Beta-prop_WDR3_1st71-134 aa

PF25174.2Beta-prop_THOC371-292 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_036176	`PF24807.2`	WD40_CDC20-Fz	8	148	2.9e-13	50.5
LXL04_036176	`PF24796.2`	WDR55	13	201	1.3e-13	51.5
LXL04_036176	`PF25172.2`	Beta-prop_WDR3_2nd	13	159	1.6e-09	38.1
LXL04_036176	`PF25175.2`	Beta-prop_WDR5	14	153	1.9e-19	70.7
LXL04_036176	`PF24814.2`	WD40_Prp19	14	168	2.6e-13	50.4
LXL04_036176	`PF23381.2`	Beta-prop_IFT122_1st	59	292	1.2e-17	64.9
LXL04_036176	`PF25173.2`	Beta-prop_WDR3_1st	71	134	7.1e-17	62.4
LXL04_036176	`PF25174.2`	Beta-prop_THOC3	71	292	9.3e-17	61.6
LXL04_036176	`PF23409.2`	Beta-prop_EML	90	287	1.9e-10	41.4
LXL04_036176	`PF00400.39`	WD40	91	123	6.3e-14	52.5
LXL04_036176	`PF24796.2`	WDR55	245	292	1.3e-13	51.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4I241`	Arabidopsis thaliana	Mitotic checkpoint protein BUB3.3	47.785%	Swiss-Prot	moderate database homology
`Q9LJN8`	Arabidopsis thaliana	Mitotic checkpoint protein BUB3.1	39.241%	Swiss-Prot	moderate database homology
`Q9C701`	Arabidopsis thaliana	Mitotic checkpoint protein BUB3.2	38.608%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card