LXL04_036067 | RubberDandelionOmics

Gene overview

LXL04_036067

Reference: OH-1004 Chr: Chr08 Coordinates: 34989861-34992369 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2148 bp · LXL04_036067|LXL04_036067|OH1004|cDNA

atgatgagGAGAATTGATGGTAGTCGAACAGGGGCATCTGATGATGTTTATAGAGTTCTCTTACAAGAAGAAGCTCTCCACGCTAATGACATCCCAGGTAACATTAACATTGATGAGGAATTTGTGACGAACTTTGACATATTAGATGGGTTTGGAGTGGAAGAATCAATACCGATGATTGAAAATAGGAGTCAGGAACCTAAAAGTGATAGTGACTATGAGGGTGACCATGAAGATAGTGATTTTTTTATTGATGAGGA...

CDS

Download CDS FASTA

2106 bp · LXL04_036067|LXL04_036067|OH1004|CDS

ATGATGAGGAGAATTGATGGTAGTCGAACAGGGGCATCTGATGATGTTTATAGAGTTCTCTTACAAGAAGAAGCTCTCCACGCTAATGACATCCCAGGTAACATTAACATTGATGAGGAATTTGTGACGAACTTTGACATATTAGATGGGTTTGGAGTGGAAGAATCAATACCGATGATTGAAAATAGGAGTCAGGAACCTAAAAGTGATAGTGACTATGAGGGTGACCATGAAGATAGTGATTTTTTTATTGATGAGGA...

Protein

Download Protein FASTA

701 aa · LXL04_036067|LXL04_036067|OH1004|PROTEIN

MMRRIDGSRTGASDDVYRVLLQEEALHANDIPGNINIDEEFVTNFDILDGFGVEESIPMIENRSQEPKSDSDYEGDHEDSDFFIDEENIIEDVEVDMEDFYMNIVPGAETNELSNEAEDIEVIDNDEFDSLSDDSRDTRRRKLLKELGKQKVCSEGEVHNVAFHIGQKYRTKKELKDKVDMHALKTKRSIFFKKNDKARLTAVCTVPVRALQDQLVKKYDVHISEDKVFRAKAVATKVVEGDYTKQYAILRDYVLELQKT...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_036067`
TK1151 ID	TkA05G473210
OH-1004 ID	LXL04_036067
Relationship / confidence	Multi Candidate From Tk1151 / Complex relationship
Protein identity (%)	77.900
Protein coverage (%)	TK1151 100.000 / OH-1004 65.050 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_036067

Location Chr08:34989861-34992369 (-)

Description Protein of unknown function

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g52520`	Putative transcription activator involved in regulating light control of development.	Arabidopsis FHY3/FAR1 gene family and distinct roles of its members in light control of Arabidopsis development.2004 · DOI: 10.1104/pp.104.052191

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_036067 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0005634 nucleus Cellular Component

GO:0008270 zinc ion binding Molecular Function

KEGG gene cross-reference

ath:AT1G52520

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.952

Rank 1 · LXL04_036067 · OH-1004

Cytoplasm0.106

Rank 2 · LXL04_036067 · OH-1004

Cell membrane0.021

Rank 3 · LXL04_036067 · OH-1004

Mitochondrion0.016

Rank 4 · LXL04_036067 · OH-1004

Endoplasmic reticulum0.013

Rank 5 · LXL04_036067 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF10551.16MULE305-400 aa

PF00872.25Transposase_mut320-447 aa

PF04434.23SWIM554-582 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_036067	`PF10551.16`	MULE	305	400	4.8e-20	72.5
LXL04_036067	`PF00872.25`	Transposase_mut	320	447	4.6e-06	26.5
LXL04_036067	`PF04434.23`	SWIM	554	582	2.1e-09	37.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SSQ4`	Arabidopsis thaliana	Protein FAR1-RELATED SEQUENCE 6	23.144%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card