LXL04_035576 | RubberDandelionOmics

Gene overview

LXL04_035576

Reference: OH-1004 Chr: Chr08 Coordinates: 24860826-24862643 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1146 bp · LXL04_035576|LXL04_035576|OH1004|cDNA

ATGAAGCAGGAGACCGTTGTAGTAATAGTAGGAGCAGGGCCTGCAGGAATCGCAACATCTGCATGTCTCAATCTTCTCTCTATTCCAAATGTCATTTTGGAGAGAGATGATTGTTATGCATCCTTATGGCAAAAGAAAGCTTACGATCGTTTAAAGCTTCACTTAGCTAAAAACTTTTGTGAACTCCCTCACATGCCATTTCCAGTTTCTGCACCTACATTTGTATCAAAATATATGTTTGTCCAATACTTGCATAGGTA...

CDS

Download CDS FASTA

1146 bp · LXL04_035576|LXL04_035576|OH1004|CDS

ATGAAGCAGGAGACCGTTGTAGTAATAGTAGGAGCAGGGCCTGCAGGAATCGCAACATCTGCATGTCTCAATCTTCTCTCTATTCCAAATGTCATTTTGGAGAGAGATGATTGTTATGCATCCTTATGGCAAAAGAAAGCTTACGATCGTTTAAAGCTTCACTTAGCTAAAAACTTTTGTGAACTCCCTCACATGCCATTTCCAGTTTCTGCACCTACATTTGTATCAAAATATATGTTTGTCCAATACTTGCATAGGTA...

Protein

Download Protein FASTA

381 aa · LXL04_035576|LXL04_035576|OH1004|PROTEIN

MKQETVVVIVGAGPAGIATSACLNLLSIPNVILERDDCYASLWQKKAYDRLKLHLAKNFCELPHMPFPVSAPTFVSKYMFVQYLHRYVSEFNVDPLYQRSVESAWYDEVAKRWMVTARNGVSGFVEEYVGEFLVVATGENSEGFIPSVYGLDSFTGSVTHSIEYQNGKKFGNKNVLVVGAGNSGMEIAYDLSNWGAQTSIVVRSPVHVLTKELVQLGMYLLKYLSCTFVDKIVLMFCKLLYGDLCKYGIQRPRKGPFCLK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_035576`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_035576

Location Chr08:24860826-24862643 (-)

Description Similar to YUC11: Probable indole-3-pyruvate monooxygenase YUCCA11

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g21430`	Involved in auxin biosynthesis.	Auxin synthesized by the YUCCA flavin monooxygenases is essential for embryogenesis and leaf formation in Arabidopsis.2007 · DOI: 10.1105/tpc.107.053009
`At1g48910`	Involved in auxin biosynthesis.	Auxin synthesized by the YUCCA flavin monooxygenases is essential for embryogenesis and leaf formation in Arabidopsis.2007 · DOI: 10.1105/tpc.107.053009
`At5g11320`	Involved in auxin biosynthesis.	Auxin biosynthesis by the YUCCA flavin monooxygenases controls the formation of floral organs and vascular tissues in Arabidopsis.2006 · DOI: 10.1101/gad.1415106 Auxin synthesized by the YUCCA flavin monooxygenases is essential for embryogenesis and leaf formation in Arabidopsis.2007 · DOI: 10.1105/tpc.107.053009
`At5g25620`	Involved in auxin biosynthesis via the indole-3-pyruvic acid (IPA) pathway.	Auxin biosynthesis by the YUCCA flavin monooxygenases controls the formation of floral organs and vascular tissues in Arabidopsis.2006 · DOI: 10.1101/gad.1415106 yucca6, a dominant mutation in Arabidopsis, affects auxin accumulation and auxin-related phenotypes.2007 · DOI: 10.1104/pp.107.104935 Overexpression of Arabidopsis YUCCA6 in potato results in high-auxin developmental phenotypes and enhanced resistance to water deficit.2013 · DOI: 10.1093/mp/sss100 The biochemical mechanism of auxin biosynthesis by an arabidopsis YUCCA flavin-containing monooxygenase.2013 · DOI: 10.1074/jbc.m112.424077
`At1g04180`	Involved in auxin biosynthesis.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_035576 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006979 response to oxidative stress Biological Process

GO:0009635 response to herbicide Biological Process

GO:0009723 response to ethylene Biological Process

GO:0009819 drought recovery Biological Process

GO:0009851 auxin biosynthetic process Biological Process

GO:0010038 response to metal ion Biological Process

GO:0010262 somatic embryogenesis Biological Process

GO:0000139 Golgi membrane Cellular Component

GO:0005576 extracellular region Cellular Component

GO:0005654 nucleoplasm Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

KEGG gene cross-reference

ath:AT1G04180

ath:AT1G21430

ath:AT1G48910

ath:AT5G11320

ath:AT5G25620

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.372

Rank 1 · LXL04_035576 · OH-1004

Endoplasmic reticulum0.200

Rank 2 · LXL04_035576 · OH-1004

Nucleus0.140

Rank 3 · LXL04_035576 · OH-1004

Peroxisome0.099

Rank 4 · LXL04_035576 · OH-1004

Lysosome / Vacuole0.098

Rank 5 · LXL04_035576 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00743.26FMO-like7-317 aa

PF07992.21Pyr_redox_27-206 aa

PF13738.13Pyr_redox_38-205 aa

PF13434.13Lys_Orn_oxgnase71-200 aa

PF00070.34Pyr_redox174-206 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_035576	`PF00743.26`	FMO-like	7	317	8.2e-21	74.8
LXL04_035576	`PF07992.21`	Pyr_redox_2	7	206	8.3e-14	52.4
LXL04_035576	`PF13738.13`	Pyr_redox_3	8	205	3.4e-22	79.8
LXL04_035576	`PF13434.13`	Lys_Orn_oxgnase	71	200	4.6e-10	39.9
LXL04_035576	`PF00070.34`	Pyr_redox	174	206	1.5e-07	32.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LPL3`	Arabidopsis thaliana	Probable indole-3-pyruvate monooxygenase YUCCA11	55.764%	Swiss-Prot	strong database homology
`Q9FVQ0`	Arabidopsis thaliana	Probable indole-3-pyruvate monooxygenase YUCCA10	55.645%	Swiss-Prot	strong database homology
`Q9LFM5`	Arabidopsis thaliana	Probable indole-3-pyruvate monooxygenase YUCCA4	46.649%	Swiss-Prot	moderate database homology
`Q8VZ59`	Arabidopsis thaliana	Indole-3-pyruvate monooxygenase YUCCA6	47.507%	Swiss-Prot	moderate database homology
`O64489`	Arabidopsis thaliana	Probable indole-3-pyruvate monooxygenase YUCCA9	47.721%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card