LXL04_035494 | RubberDandelionOmics

Gene overview

LXL04_035494

Reference: OH-1004 Chr: Chr08 Coordinates: 23551212-23552621 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

924 bp · LXL04_035494|LXL04_035494|OH1004|cDNA

ATGGAAATGCAACGTGGAACAAGACTATGTCAAATATTAACATCCTTCAAATGTGGTGGTTTTGCACTCGGTGTGGCGACAAACCATGCTACTTTCGATGGCATAAGCTTCAAAACCTTCCTAGAAAACATTGCTTCTTTGGCCGGTGGTAAACCGCTCGCCACCACTCCATGCAATGACCGCCACCTCTTGGCGGCAAGATCACCACCCAATATCCAATTTGACCACCCGGAACTACTCAAGCTCCCAACCGGAATCGA...

CDS

Download CDS FASTA

924 bp · LXL04_035494|LXL04_035494|OH1004|CDS

ATGGAAATGCAACGTGGAACAAGACTATGTCAAATATTAACATCCTTCAAATGTGGTGGTTTTGCACTCGGTGTGGCGACAAACCATGCTACTTTCGATGGCATAAGCTTCAAAACCTTCCTAGAAAACATTGCTTCTTTGGCCGGTGGTAAACCGCTCGCCACCACTCCATGCAATGACCGCCACCTCTTGGCGGCAAGATCACCACCCAATATCCAATTTGACCACCCGGAACTACTCAAGCTCCCAACCGGAATCGA...

Protein

Download Protein FASTA

307 aa · LXL04_035494|LXL04_035494|OH1004|PROTEIN

MEMQRGTRLCQILTSFKCGGFALGVATNHATFDGISFKTFLENIASLAGGKPLATTPCNDRHLLAARSPPNIQFDHPELLKLPTGIDLPTPTVFDCPEGELDFKIFKLTSNDIAHLKQKAKDGPISTTAKVTGFNVVAAHVWRCKALSSGIDYNPERVSRVLYAVDIRGRLDLPPSYAGNAVLSAYASASCKEIEEGPLSKLVEMVAEGSKRMTGEYAQSVIDWGEVNKGFPNGEFLISSWWRLGFAGVEYPWGKPRYSC...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_035494`
TK1151 ID	TkA04G127110
OH-1004 ID	LXL04_035494
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	99.700
Protein coverage (%)	TK1151 65.265 / OH-1004 96.091 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_035494

Location Chr08:23551212-23552621 (-)

Description Similar to HHT1: Omega-hydroxypalmitate O-feruloyl transferase

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g65450`	Required for double fertilization of the egg cell and the central cell by two sperm cells, resulting in the formation of the embryo and the endosperm.	Molecular characterization of the glauce mutant: a central cell-specific function is required for double fertilization in Arabidopsis.2012 · DOI: 10.1105/tpc.112.096420
`At5g41040`	Involved in the synthesis of aromatics of the suberin polymer.	Identification of an Arabidopsis feruloyl-coenzyme A transferase required for suberin synthesis.2009 · DOI: 10.1104/pp.109.144907 A hydroxycinnamoyltransferase responsible for synthesizing suberin aromatics in Arabidopsis.2009 · DOI: 10.1073/pnas.0905555106
`At5g63560`	Involved in the synthesis of alkyl hydroxycinnamates in root waxes.	Identification of an Arabidopsis fatty alcohol:caffeoyl-Coenzyme A acyltransferase required for the synthesis of alkyl hydroxycinnamates in root waxes.2012 · DOI: 10.1104/pp.112.201822

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_035494 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0009567 double fertilization forming a zygote and endosperm Biological Process

GO:0010345 suberin biosynthetic process Biological Process

GO:0052325 cell wall pectin biosynthetic process Biological Process

GO:0071555 cell wall organization Biological Process

GO:0090431 alkyl caffeate ester biosynthetic process Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0009536 plastid Cellular Component

GO:0016747 acyltransferase activity, transferring groups other than amino-acyl groups Molecular Function

GO:0047172 shikimate O-hydroxycinnamoyltransferase activity Molecular Function

GO:0050266 rosmarinate synthase activity Molecular Function

KEGG gene cross-reference

ath:AT1G65450

ath:AT5G41040

ath:AT5G63560

nta:107796658

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.595

Rank 1 · LXL04_035494 · OH-1004

Nucleus0.228

Rank 2 · LXL04_035494 · OH-1004

Plastid0.132

Rank 3 · LXL04_035494 · OH-1004

Endoplasmic reticulum0.119

Rank 4 · LXL04_035494 · OH-1004

Cell membrane0.081

Rank 5 · LXL04_035494 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02458.21Transferase13-300 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_035494	`PF02458.21`	Transferase	13	300	2.1e-72	244.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O80816`	Arabidopsis thaliana	Acyltransferase GLAUCE	62.126%	Swiss-Prot	strong database homology
`Q94CD1`	Arabidopsis thaliana	Omega-hydroxypalmitate O-feruloyl transferase	32.667%	Swiss-Prot	moderate database homology
`Q9FFQ7`	Arabidopsis thaliana	Fatty alcohol:caffeoyl-CoA acyltransferase	32.313%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card