LXL04_035379 | RubberDandelionOmics

Gene overview

LXL04_035379

Reference: OH-1004 Chr: Chr08 Coordinates: 21429321-21432966 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1425 bp · LXL04_035379|LXL04_035379|OH1004|cDNA

ATGTATGTGGTGTTGGTGATGGAGATGAAGATAGAGACGGTAGCGAGAGTGGAGATGAAGAAGCATCGAGAGTGGAGCAGTCAAAACAGACGCGAGGGATACGAAAGGACGGTAGGATCAGCACACGTGGCCGTTAAATCGCCCCCAAATAAAAACGGGTTTCACGAGAACGCTCTAAACCCAATTGGTGAAGCAAAGCACTGCAACTTAGAGATGAAGGGATCGACGGAGACGAAGTTCTTACAGGAACTGGTGTTGTA...

CDS

Download CDS FASTA

1425 bp · LXL04_035379|LXL04_035379|OH1004|CDS

ATGTATGTGGTGTTGGTGATGGAGATGAAGATAGAGACGGTAGCGAGAGTGGAGATGAAGAAGCATCGAGAGTGGAGCAGTCAAAACAGACGCGAGGGATACGAAAGGACGGTAGGATCAGCACACGTGGCCGTTAAATCGCCCCCAAATAAAAACGGGTTTCACGAGAACGCTCTAAACCCAATTGGTGAAGCAAAGCACTGCAACTTAGAGATGAAGGGATCGACGGAGACGAAGTTCTTACAGGAACTGGTGTTGTA...

Protein

Download Protein FASTA

474 aa · LXL04_035379|LXL04_035379|OH1004|PROTEIN

MYVVLVMEMKIETVARVEMKKHREWSSQNRREGYERTVGSAHVAVKSPPNKNGFHENALNPIGEAKHCNLEMKGSTETKFLQELVLYAASAALSCLVLFAGLKHLDPNREASKKALEQKKEISKRLGRPLIHTNPYEVDNCCLRLQLTNSDVIACNVINPDHIDVEFDSIGGLETIKQALYELVILPLRRPELFSYGKLLGPQKGVLLYGPPGTGKTMLAKAIAKESGAVFINVRISDLMSKWFGDAQKLVAAVFSLAYK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_035379`
TK1151 ID	TkA04G140680
OH-1004 ID	LXL04_035379
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	96.800
Protein coverage (%)	TK1151 100.000 / OH-1004 85.021 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`LXL04_035379`
Location	Chr08:21429321-21432966 (-)
Description	Similar to atad1a: ATPase family AAA domain-containing protein 1-A
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_035379` · GCA_047496595.1_OSU_TarKok_2.0.
GO annotations (OH1004 source)	GO:0002092 positive regulation of receptor internalization Biological Process GO:0009653 anatomical structure morphogenesis Biological Process GO:0140570 extraction of mislocalized protein from mitochondrial outer membrane Biological Process GO:0005739 mitochondrion Cellular Component GO:0005741 mitochondrial outer membrane Cellular Component GO:0005778 peroxisomal membrane Cellular Component GO:0005829 cytosol Cellular Component GO:0016020 membrane Cellular Component GO:0005524 ATP binding Molecular Function GO:0016887 ATP hydrolysis activity Molecular Function GO:0140567 membrane protein dislocase activity Molecular Function
KEGG gene cross-reference	bta:506045 hsa:84896 mmu:67979 rno:309532 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.358

Rank 1 · LXL04_035379 · OH-1004

Peroxisome0.235

Rank 2 · LXL04_035379 · OH-1004

Cytoplasm0.200

Rank 3 · LXL04_035379 · OH-1004

Nucleus0.120

Rank 4 · LXL04_035379 · OH-1004

Endoplasmic reticulum0.107

Rank 5 · LXL04_035379 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07728.21AAA_5205-328 aa

PF05496.19RuvB_N205-273 aa

PF00004.36AAA206-335 aa

PF17862.8AAA_lid_3359-393 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_035379	`PF07728.21`	AAA_5	205	328	6.1e-07	30.2
LXL04_035379	`PF05496.19`	RuvB_N	205	273	6.3e-06	26.7
LXL04_035379	`PF00004.36`	AAA	206	335	2.2e-37	129.2
LXL04_035379	`PF17862.8`	AAA_lid_3	359	393	1.7e-10	41.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card