LXL04_035325 | RubberDandelionOmics

Gene overview

LXL04_035325

Reference: OH-1004 Chr: Chr08 Coordinates: 20356930-20360083 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2007 bp · LXL04_035325|LXL04_035325|OH1004|cDNA

ATGGCTGCTTCAGAGGAGACCAGTGCACTCTTCCCAATCTTCATTTTGACGATGATTGCATTGCCACTTGTACCTTATACAATCATGCAGCTGTGCCGTGCTGCCTCAAAGAAAGCAAAGAGCATCAATTGTCAGTGCTCTATCTCAAACTTCTCAACATGGAGTAACTTGACATTGGTGCTGTTTTGGATCATCATGGGTGTCCTTGTGTACTATATCAAGACCATAAATCGCGAAGTTCAAGTATTCGAGCCATTTAG...

CDS

Download CDS FASTA

2007 bp · LXL04_035325|LXL04_035325|OH1004|CDS

ATGGCTGCTTCAGAGGAGACCAGTGCACTCTTCCCAATCTTCATTTTGACGATGATTGCATTGCCACTTGTACCTTATACAATCATGCAGCTGTGCCGTGCTGCCTCAAAGAAAGCAAAGAGCATCAATTGTCAGTGCTCTATCTCAAACTTCTCAACATGGAGTAACTTGACATTGGTGCTGTTTTGGATCATCATGGGTGTCCTTGTGTACTATATCAAGACCATAAATCGCGAAGTTCAAGTATTCGAGCCATTTAG...

Protein

Download Protein FASTA

668 aa · LXL04_035325|LXL04_035325|OH1004|PROTEIN

MAASEETSALFPIFILTMIALPLVPYTIMQLCRAASKKAKSINCQCSISNFSTWSNLTLVLFWIIMGVLVYYIKTINREVQVFEPFSILGLQHGASDSEIKKAYRRLSVQYHPDKNPDPEAHKYFVESIAKAYQALTDPISRENFEKYGHPDGRQGFQMGIALPSFLLNIEGASGGILLLWIVGVCILLPLVVAVAYLSRSSKYTGNYVMHQTLSAYYYFMKPSLAPSKVMDVLIKAAEYMEIPVRRSDGEPLQKLFMLV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_035325`
TK1151 ID	TkA04G142420
OH-1004 ID	LXL04_035325
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	99.600
Protein coverage (%)	TK1151 100.000 / OH-1004 40.120 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_035325

Location Chr08:20356930-20360083 (+)

Description Similar to ERDJ2A: DnaJ protein ERDJ2A

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g79940`	Required for integral membrane and secreted preprotein translocation across the endoplasmic reticulum membrane.	No verified direct reference in this release
`At4g21180`	Required for integral membrane and secreted preprotein translocation across the endoplasmic reticulum membrane.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os04g0307200`	May be required for integral membrane and secreted preprotein translocation across the endoplasmic reticulum membrane.	Analysis of rice ER-resident J-proteins reveals diversity and functional differentiation of the ER-resident Hsp70 system in plants.2013 · DOI: 10.1093/jxb/ert312

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_035325 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006614 SRP-dependent cotranslational protein targeting to membrane Biological Process

GO:0006620 post-translational protein targeting to endoplasmic reticulum membrane Biological Process

GO:0015031 protein transport Biological Process

GO:0031204 post-translational protein targeting to membrane, translocation Biological Process

GO:0071941 nitrogen cycle metabolic process Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005789 endoplasmic reticulum membrane Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0016020 membrane Cellular Component

KEGG gene cross-reference

ath:AT1G79940

ath:AT4G21180

dosa:Os04g0307200

mmu:140740

pon:100173604

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.709

Rank 1 · LXL04_035325 · OH-1004

Nucleus0.222

Rank 2 · LXL04_035325 · OH-1004

Cytoplasm0.116

Rank 3 · LXL04_035325 · OH-1004

Golgi apparatus0.105

Rank 4 · LXL04_035325 · OH-1004

Cell membrane0.073

Rank 5 · LXL04_035325 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00226.37DnaJ85-145 aa

PF02889.22Sec63207-583 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_035325	`PF00226.37`	DnaJ	85	145	5.7e-20	71.9
LXL04_035325	`PF02889.22`	Sec63	207	583	8.5e-22	78.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q0WT48`	Arabidopsis thaliana	DnaJ protein ERDJ2A	75.120%	Swiss-Prot	strong database homology
`F4JIN3`	Arabidopsis thaliana	DnaJ protein ERDJ2B	66.283%	Swiss-Prot	strong database homology
`Q7XVN7`	Oryza sativa subsp. japonica	DnaJ protein ERDJ2	71.338%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card