LXL04_035112 | RubberDandelionOmics

Gene overview

LXL04_035112

Reference: OH-1004 Chr: Chr08 Coordinates: 14752300-14753610 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

852 bp · LXL04_035112|LXL04_035112|OH1004|cDNA

ATGTTTGATGAATCCGATCAATCGGCCTTGGGACACCGCCCGACTTCGCCGTTGGCGGCCTTTGCTGCTGCGATCGGCCATTCCGTTGGCTttgccagcggtaaactccTCACGTGGCAATGCCGCTGCTATTTGGCCGACGATTCCGTTCAGTCTAATATTGCTAATTTTGACTTGATTATAAAAGGTGGGCCACGGGCGGTAGGAGATGGCGATGGTGTAATAGTCTATGTTAGTACCTCAGATGCTCGGGAGTTGGC...

CDS

Download CDS FASTA

852 bp · LXL04_035112|LXL04_035112|OH1004|CDS

ATGTTTGATGAATCCGATCAATCGGCCTTGGGACACCGCCCGACTTCGCCGTTGGCGGCCTTTGCTGCTGCGATCGGCCATTCCGTTGGCTTTGCCAGCGGTAAACTCCTCACGTGGCAATGCCGCTGCTATTTGGCCGACGATTCCGTTCAGTCTAATATTGCTAATTTTGACTTGATTATAAAAGGTGGGCCACGGGCGGTAGGAGATGGCGATGGTGTAATAGTCTATGTTAGTACCTCAGATGCTCGGGAGTTGGC...

Protein

Download Protein FASTA

283 aa · LXL04_035112|LXL04_035112|OH1004|PROTEIN

MFDESDQSALGHRPTSPLAAFAAAIGHSVGFASGKLLTWQCRCYLADDSVQSNIANFDLIIKGGPRAVGDGDGVIVYVSTSDARELARVSVPLEIQMTVGERKKARAQRNNAMAEALYTQIKDAGYGGIDAPENEMRYGIDAKNELVKIIGGKCLRIFIFYEDQYGRFVGDMYCDDIFVQEVMLKKGLASYDNRPEFRKWEKDARAMKIGLWASPNPEKPWEWRKNQRDRSEKLCLLYCFFALLGVGVMLLGAGAMLLGA...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_035112`
TK1151 ID	TkA04G166690
OH-1004 ID	LXL04_035112
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	95.200
Protein coverage (%)	TK1151 91.772 / OH-1004 51.237 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_035112

Location Chr08:14752300-14753610 (-)

Description Similar to Uncharacterized 38.1 kDa protein

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g40410`	Enzyme that catalyzes the hydrolysis of both DNA and RNA at the 5' position of the phosphodiester bond.	Molecular cloning, expression, and characterization of a Ca2+-dependent nuclease of Arabidopsis thaliana.2012 · DOI: 10.1016/j.pep.2012.03.007 Plant plasma membrane-bound staphylococcal-like DNases as a novel class of eukaryotic nucleases.2012 · DOI: 10.1186/1471-2229-12-195 Arabidopsis cysteine proteinase inhibitor AtCYSb interacts with a Ca(2+)-dependent nuclease, AtCaN2.2013 · DOI: 10.1016/j.febslet.2013.09.019
`At3g56170`	Enzyme that catalyzes the hydrolysis of both DNA and RNA at the 5' position of the phosphodiester bond.	Plant plasma membrane-bound staphylococcal-like DNases as a novel class of eukaryotic nucleases.2012 · DOI: 10.1186/1471-2229-12-195

Rice

Reference gene ID	Possible function	Papers / DOI
`Os12g0109200`	Enzyme that catalyzes the hydrolysis of both DNA and RNA at the 5' position of the phosphodiester bond.	No verified direct reference in this release
`Os11g0109500`	Enzyme that catalyzes the hydrolysis of both DNA and RNA at the 5' position of the phosphodiester bond.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_035112 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006308 DNA catabolic process Biological Process

GO:0006401 RNA catabolic process Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0003676 nucleic acid binding Molecular Function

GO:0004518 nuclease activity Molecular Function

GO:0004519 endonuclease activity Molecular Function

GO:0004520 DNA endonuclease activity Molecular Function

GO:0004521 RNA endonuclease activity Molecular Function

GO:0016787 hydrolase activity Molecular Function

GO:0046872 metal ion binding Molecular Function

KEGG gene cross-reference

ath:AT2G40410

ath:AT3G56170

dosa:Os11g0109500

dosa:Os12g0109200

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.206

Rank 1 · LXL04_035112 · OH-1004

Cytoplasm0.201

Rank 2 · LXL04_035112 · OH-1004

Extracellular0.154

Rank 3 · LXL04_035112 · OH-1004

Plastid0.152

Rank 4 · LXL04_035112 · OH-1004

Endoplasmic reticulum0.146

Rank 5 · LXL04_035112 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00565.24SNase127-213 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_035112	`PF00565.24`	SNase	127	213	6.4e-17	62.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4IH31`	Arabidopsis thaliana	Staphylococcal-like nuclease CAN2	49.733%	Swiss-Prot	moderate database homology
`F4IZC5`	Arabidopsis thaliana	Staphylococcal-like nuclease CAN1	47.312%	Swiss-Prot	moderate database homology
`Q2QYR1`	Oryza sativa subsp. japonica	Probable staphylococcal-like nuclease CAN3	45.408%	Swiss-Prot	moderate database homology
`Q2RBJ2`	Oryza sativa subsp. japonica	Probable staphylococcal-like nuclease CAN2	44.898%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card