LXL04_033453 | RubberDandelionOmics

Gene overview

LXL04_033453

Reference: OH-1004 Chr: Chr07 Coordinates: 44149817-44151766 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1950 bp · LXL04_033453|LXL04_033453|OH1004|cDNA

ATGGCATCTTGCTTCCAACATCCCACCATCGAAGATGACTCCACCGCCCTCTTCACCGCTTCCGACACCTCCCCGGAGCAATCCAGCACCCCCTCCTCCTCCTCCCGCCAttcaccgccaccaccaccttACCCCTCCAAACCATCTTACAAACTCACTGTCAAAAACCTCTCATACACCATCAAATCAAGCTACCAAATCACACTACCATGGCTCCTAAACAAATCAAAACGAATCGATATCCTCAAATCAGTATCCTT...

CDS

Download CDS FASTA

1950 bp · LXL04_033453|LXL04_033453|OH1004|CDS

ATGGCATCTTGCTTCCAACATCCCACCATCGAAGATGACTCCACCGCCCTCTTCACCGCTTCCGACACCTCCCCGGAGCAATCCAGCACCCCCTCCTCCTCCTCCCGCCATTCACCGCCACCACCACCTTACCCCTCCAAACCATCTTACAAACTCACTGTCAAAAACCTCTCATACACCATCAAATCAAGCTACCAAATCACACTACCATGGCTCCTAAACAAATCAAAACGAATCGATATCCTCAAATCAGTATCCTT...

Protein

Download Protein FASTA

649 aa · LXL04_033453|LXL04_033453|OH1004|PROTEIN

MASCFQHPTIEDDSTALFTASDTSPEQSSTPSSSSRHSPPPPPYPSKPSYKLTVKNLSYTIKSSYQITLPWLLNKSKRIDILKSVSFTAQSSEIMAIVGPSGSGKSSLLHFISGRVRDNTWDPKTTISLNDFPITSPSQMKKICGFVAQEDNLLPLLTVKETLMYSAKFRLTEMSSKEKEHRVECLIHELGLVHVRNSYIGDEDDRGISGGERKRVSIGVDMIPDPPILLLDEPTSGLDSSSALQVVELLSNMSTSKQRT...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_033453`
TK1151 ID	TkA08G257630
OH-1004 ID	LXL04_033453
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	96.900
Protein coverage (%)	TK1151 100.000 / OH-1004 85.516 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_033453

Location Chr07:44149817-44151766 (+)

Description Similar to ABCG23: ABC transporter G family member 23

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g19410`	ABC transporter G family member 23.	No verified direct reference in this release
`At5g52860`	ABC transporter G family member 8.	No verified direct reference in this release
`At4g25750`	ABC transporter G family member 4.	No verified direct reference in this release
`At1g53270`	ABC transporter G family member 10.	No verified direct reference in this release
`At2g13610`	ABC transporter G family member 5.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_033453 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0055085 transmembrane transport Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0016020 membrane Cellular Component

GO:0005524 ATP binding Molecular Function

GO:0016887 ATP hydrolysis activity Molecular Function

GO:0042626 ATPase-coupled transmembrane transporter activity Molecular Function

GO:0140359 ABC-type transporter activity Molecular Function

KEGG gene cross-reference

ath:AT1G53270

ath:AT2G13610

ath:AT4G25750

ath:AT5G19410

ath:AT5G52860

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.325

Rank 1 · LXL04_033453 · OH-1004

Lysosome / Vacuole0.291

Rank 2 · LXL04_033453 · OH-1004

Endoplasmic reticulum0.233

Rank 3 · LXL04_033453 · OH-1004

Cytoplasm0.103

Rank 4 · LXL04_033453 · OH-1004

Golgi apparatus0.099

Rank 5 · LXL04_033453 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00005.34ABC_tran82-236 aa

PF01061.30ABC2_membrane374-583 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_033453	`PF00005.34`	ABC_tran	82	236	1.6e-26	94.3
LXL04_033453	`PF01061.30`	ABC2_membrane	374	583	2e-49	168.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q3E9B8`	Arabidopsis thaliana	ABC transporter G family member 23	63.110%	Swiss-Prot	strong database homology
`Q9FLX5`	Arabidopsis thaliana	ABC transporter G family member 8	44.901%	Swiss-Prot	moderate database homology
`Q9SW08`	Arabidopsis thaliana	ABC transporter G family member 4	44.073%	Swiss-Prot	moderate database homology
`Q9MAH4`	Arabidopsis thaliana	ABC transporter G family member 10	44.444%	Swiss-Prot	moderate database homology
`Q9SIT6`	Arabidopsis thaliana	ABC transporter G family member 5	44.147%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card