LXL04_033107 | RubberDandelionOmics

Gene overview

LXL04_033107

Reference: OH-1004 Chr: Chr07 Coordinates: 36125661-36126764 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1104 bp · LXL04_033107|LXL04_033107|OH1004|cDNA

ATGGGTAGCTTAACCTTCCGTTGGTGGATTACAGCTGTTTTGGTGTTCGCCGTCGGTGTGACGGTGGATGCTTGCCCGGCGTCGGATAGGGCATCGTTGCTCGCCTTCAAAGCTGCTTTACATGAACCTCATTTGGGCATCTTTAATTCGTGGACGGGCACCGACTGTTGTAACAAATGGTACGGTATTACTTGCGACCCGACTACTAAACGGGTTGCGGATATAGCGCTCCGTGGAGAGTCCGAGGATCCAATTTTTCA...

CDS

Download CDS FASTA

1104 bp · LXL04_033107|LXL04_033107|OH1004|CDS

ATGGGTAGCTTAACCTTCCGTTGGTGGATTACAGCTGTTTTGGTGTTCGCCGTCGGTGTGACGGTGGATGCTTGCCCGGCGTCGGATAGGGCATCGTTGCTCGCCTTCAAAGCTGCTTTACATGAACCTCATTTGGGCATCTTTAATTCGTGGACGGGCACCGACTGTTGTAACAAATGGTACGGTATTACTTGCGACCCGACTACTAAACGGGTTGCGGATATAGCGCTCCGTGGAGAGTCCGAGGATCCAATTTTTCA...

Protein

Download Protein FASTA

367 aa · LXL04_033107|LXL04_033107|OH1004|PROTEIN

MGSLTFRWWITAVLVFAVGVTVDACPASDRASLLAFKAALHEPHLGIFNSWTGTDCCNKWYGITCDPTTKRVADIALRGESEDPIFQKAKRTGYMTGSISPAICNLERLSNVIISDWKGISGTVPSCITSLPFLRHLDLVGNQISGEIPSDIGKLHLLTVLNLADNKITGRIPRSIANLTSLMHLDLRNNMISGTIPINIGKLRMLSRALLSNNQISGMIPNTISYIYRLSDLDLSLNRISGPIPDSLGKMGVLATLNLD...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_033107`
TK1151 ID	TkA08G231040
OH-1004 ID	LXL04_033107
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	98.600
Protein coverage (%)	TK1151 68.246 / OH-1004 39.237 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_033107

Location Chr07:36125661-36126764 (-)

Description Similar to DRT100: DNA damage-repair/toleration protein DRT100

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g12610`	This protein is able to complement bacterial recA mutations, but its native function in the plant is not known.	No verified direct reference in this release
`At3g56370`	Probable LRR receptor-like serine/threonine-protein kinase IRK.	No verified direct reference in this release
`At5g46330`	Constitutes the pattern-recognition receptor (PPR) that determines the specific perception of flagellin (flg22), a potent elicitor of the defense response to pathogen-associated molecular patterns (PAMPs).	No verified direct reference in this release
`At3g12145`	Promotes flowering transition in long days (LD).	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_033107 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006281 DNA repair Biological Process

GO:0007165 signal transduction Biological Process

GO:0010228 vegetative to reproductive phase transition of meristem Biological Process

GO:0048364 root development Biological Process

GO:0048510 regulation of timing of transition from vegetative to reproductive phase Biological Process

GO:0048574 long-day photoperiodism, flowering Biological Process

GO:0051302 regulation of cell division Biological Process

GO:0090511 periclinal cell division Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005886 plasma membrane Cellular Component

KEGG gene cross-reference

ath:AT3G12145

ath:AT3G12610

ath:AT3G56370

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.584

Rank 1 · LXL04_033107 · OH-1004

Extracellular0.210

Rank 2 · LXL04_033107 · OH-1004

Endoplasmic reticulum0.098

Rank 3 · LXL04_033107 · OH-1004

Cytoplasm0.079

Rank 4 · LXL04_033107 · OH-1004

Nucleus0.035

Rank 5 · LXL04_033107 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08263.18LRRNT_227-66 aa

PF23598.2LRR_14127-208 aa

PF12799.14LRR_4134-169 aa

PF13855.13LRR_8154-192 aa

PF12799.14LRR_4158-193 aa

PF13855.13LRR_8211-264 aa

PF13855.13LRR_8277-335 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_033107	`PF08263.18`	LRRNT_2	27	66	1.9e-11	44.8
LXL04_033107	`PF23598.2`	LRR_14	127	208	2.7e-14	53.4
LXL04_033107	`PF12799.14`	LRR_4	134	169	9.4e-10	39.1
LXL04_033107	`PF13855.13`	LRR_8	154	192	1.2e-22	80.2
LXL04_033107	`PF12799.14`	LRR_4	158	193	9.4e-10	39.1
LXL04_033107	`PF13855.13`	LRR_8	211	264	1.2e-22	80.2
LXL04_033107	`PF13855.13`	LRR_8	277	335	1.2e-22	80.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q00874`	Arabidopsis thaliana	DNA damage-repair/toleration protein DRT100	57.895%	Swiss-Prot	strong database homology
`Q9LY03`	Arabidopsis thaliana	Probable LRR receptor-like serine/threonine-protein kinase IRK	34.604%	Swiss-Prot	moderate database homology
`Q9FL28`	Arabidopsis thaliana	LRR receptor-like serine/threonine-protein kinase FLS2	34.983%	Swiss-Prot	moderate database homology
`Q9LH52`	Arabidopsis thaliana	Leucine-rich repeat protein FLOR 1	31.792%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card