LXL04_033076 | RubberDandelionOmics

Gene overview

LXL04_033076

Reference: OH-1004 Chr: Chr07 Coordinates: 35475839-35477308 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

690 bp · LXL04_033076|LXL04_033076|OH1004|cDNA

ATGTCGATGGAGAAAAAAGCTGAAAGTGGAAGAAGCAAAAAAGGGGAAACAGCTCCGGCAACGGTGAAAGCCAACGGCAAACGTAAGATTAAGAAAAATGCTGAAGACGATGTACTGGAGGAAGTTCCGATTATTCAGCTCGTAAGTTCCAGTTCTCAAAACCACGAGAGGAATGGAGTGAATACAGAATCATTCGTAGAACAAGTGGGAGTGTCTGGTAAAGAGGATGTCGTTGATGGTTGTGTAGAGGCGGAGGAGGC...

CDS

Download CDS FASTA

690 bp · LXL04_033076|LXL04_033076|OH1004|CDS

ATGTCGATGGAGAAAAAAGCTGAAAGTGGAAGAAGCAAAAAAGGGGAAACAGCTCCGGCAACGGTGAAAGCCAACGGCAAACGTAAGATTAAGAAAAATGCTGAAGACGATGTACTGGAGGAAGTTCCGATTATTCAGCTCGTAAGTTCCAGTTCTCAAAACCACGAGAGGAATGGAGTGAATACAGAATCATTCGTAGAACAAGTGGGAGTGTCTGGTAAAGAGGATGTCGTTGATGGTTGTGTAGAGGCGGAGGAGGC...

Protein

Download Protein FASTA

229 aa · LXL04_033076|LXL04_033076|OH1004|PROTEIN

MSMEKKAESGRSKKGETAPATVKANGKRKIKKNAEDDVLEEVPIIQLVSSSSQNHERNGVNTESFVEQVGVSGKEDVVDGCVEAEEATKSNEVSKKKKKKKKEKAKDEVKEDTNQKKKKEVGEEIEEKDSSSLYQIPMNRVSRIIKVEDPNVRITQDAVFIINKASEKFLQLFTTEAYASAFLDHKKHIGYKHLSSVVSKRRRFDFLSDFVPEKVKAEDALKESPAVET

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_033076`
TK1151 ID	TkA08G229030
OH-1004 ID	LXL04_033076
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	90.400
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_033076

Location Chr07:35475839-35477308 (+)

Description Similar to DPB3: DNA polymerase epsilon subunit C (Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968)

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g07980`	Transcription factor which promotes the expression of heat stress-inducible genes by contributing to the formation of a heat stress-specific transcriptional complex with NF-Y subunits (e.g. NF-YA2 and NF-YB3) and DREB2A at the promoter of target genes, thus promoting heat tolerance.	Arabidopsis DPB3-1, a DREB2A interactor, specifically enhances heat stress-induced gene expression by forming a heat stress-specific transcriptional complex with NF-Y subunits.2014 · DOI: 10.1105/tpc.114.132928 Nuclear moonlighting of cytosolic glyceraldehyde-3-phosphate dehydrogenase regulates Arabidopsis response to heat stress.2020 · DOI: 10.1038/s41467-020-17311-4

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_033076 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006261 DNA-templated DNA replication Biological Process

GO:0006275 regulation of DNA replication Biological Process

GO:0006334 nucleosome assembly Biological Process

GO:0006335 DNA replication-dependent chromatin assembly Biological Process

GO:0006338 chromatin remodeling Biological Process

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0009408 response to heat Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0040029 epigenetic regulation of gene expression Biological Process

GO:0045893 positive regulation of DNA-templated transcription Biological Process

GO:0140529 CMG complex assembly Biological Process

KEGG gene cross-reference

ath:AT1G07980

dha:DEHA2B06820g

hsa:54108

mmu:93696

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.981

Rank 1 · LXL04_033076 · OH-1004

Cytoplasm0.067

Rank 2 · LXL04_033076 · OH-1004

Cell membrane0.017

Rank 3 · LXL04_033076 · OH-1004

Endoplasmic reticulum0.011

Rank 4 · LXL04_033076 · OH-1004

Mitochondrion0.006

Rank 5 · LXL04_033076 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00125.31Histone123-198 aa

PF00808.30CBFD_NFYB_HMF135-198 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_033076	`PF00125.31`	Histone	123	198	9.3e-07	29.9
LXL04_033076	`PF00808.30`	CBFD_NFYB_HMF	135	198	7.3e-13	49.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LN09`	Arabidopsis thaliana	DNA polymerase II subunit B3-1	55.056%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card