LXL04_032064 | RubberDandelionOmics

Gene overview

LXL04_032064

Reference: OH-1004 Chr: Chr07 Coordinates: 15857952-15859373 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1422 bp · LXL04_032064|LXL04_032064|OH1004|cDNA

ATGACTGCCTTTTTTTCCATCATAACCCTTATATTATTAATTCCTACATGTCTCTCGTTTACGGTTATTATGTCTGATTCAGGGGTTCCGTCTGCTCTTGTTGACGCCCCTCAAACAGGGTTTTCCATGAACAACAATGGCGCTACAACAGACCATGATGAGCAACAAGCGGTTTACGACATCATGAAAGCTACTGGAAACGACTGGGCTACTGACATCCCCGATGTCTGTCGGGGACGGTGGCACGGGATCGAATGCAT...

CDS

Download CDS FASTA

1422 bp · LXL04_032064|LXL04_032064|OH1004|CDS

ATGACTGCCTTTTTTTCCATCATAACCCTTATATTATTAATTCCTACATGTCTCTCGTTTACGGTTATTATGTCTGATTCAGGGGTTCCGTCTGCTCTTGTTGACGCCCCTCAAACAGGGTTTTCCATGAACAACAATGGCGCTACAACAGACCATGATGAGCAACAAGCGGTTTACGACATCATGAAAGCTACTGGAAACGACTGGGCTACTGACATCCCCGATGTCTGTCGGGGACGGTGGCACGGGATCGAATGCAT...

Protein

Download Protein FASTA

473 aa · LXL04_032064|LXL04_032064|OH1004|PROTEIN

MTAFFSIITLILLIPTCLSFTVIMSDSGVPSALVDAPQTGFSMNNNGATTDHDEQQAVYDIMKATGNDWATDIPDVCRGRWHGIECMPDKNNVFHVVSLSFGALSDDTAFPTCDPTRSYISPSITKLPHIRTLFFYRCFTDKPQPIPSFLGLLGPTLQTLVLRENGHVGPIPTQLGNLTGLRVLDLHKNNLNGSIPASFSRFTGLRSLDLSSNKLTGSIPSFAFPELTILDLNQNHLTGSIPTAIGNCDSLMKIDLSRNR...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_032064`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_032064

Location Chr07:15857952-15859373 (-)

Description Similar to TMM: Protein TOO MANY MOUTHS

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g80080`	Promotes cell fate progression in stomatal development.	No verified direct reference in this release
`At2g42800`	Receptor like protein 29.	No verified direct reference in this release
`At1g13230`	Required for growth promotion and enhanced seed production mediated by the endophytic fungus Piriformospora indica.	A leucine-rich repeat protein is required for growth promotion and enhanced seed production mediated by the endophytic fungus Piriformospora indica in Arabidopsis thaliana.2007 · DOI: 10.1111/j.1365-313x.2007.03028.x
`At1g35710`	Probable leucine-rich repeat receptor-like protein kinase At1g35710.	No verified direct reference in this release
`At2g25790`	Receptor with a serine/threonine-protein kinase activity (By similarity).	A novel pollen-pistil interaction conferring high-temperature tolerance during reproduction via CLE45 signaling.2013 · DOI: 10.1016/j.cub.2013.06.060 Arabidopsis MAKR5 is a positive effector of BAM3-dependent CLE45 signaling.2016 · DOI: 10.15252/embr.201642450

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_032064 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0007165 signal transduction Biological Process

GO:0008356 asymmetric cell division Biological Process

GO:0009610 response to symbiotic fungus Biological Process

GO:0009620 response to fungus Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0009755 hormone-mediated signaling pathway Biological Process

GO:0010090 trichome morphogenesis Biological Process

GO:0010375 stomatal complex patterning Biological Process

GO:0010376 stomatal complex formation Biological Process

GO:0044403 biological process involved in symbiotic interaction Biological Process

GO:0045087 innate immune response Biological Process

GO:0050832 defense response to fungus Biological Process

KEGG gene cross-reference

ath:AT1G13230

ath:AT1G35710

ath:AT1G80080

ath:AT2G42800

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.713

Rank 1 · LXL04_032064 · OH-1004

Endoplasmic reticulum0.096

Rank 2 · LXL04_032064 · OH-1004

Extracellular0.083

Rank 3 · LXL04_032064 · OH-1004

Cytoplasm0.078

Rank 4 · LXL04_032064 · OH-1004

Nucleus0.046

Rank 5 · LXL04_032064 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF23598.2LRR_14122-221 aa

PF13855.13LRR_8155-215 aa

PF23598.2LRR_14200-303 aa

PF12799.14LRR_4204-237 aa

PF13855.13LRR_8225-285 aa

PF13855.13LRR_8250-309 aa

PF13855.13LRR_8298-358 aa

PF13855.13LRR_8323-382 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_032064	`PF23598.2`	LRR_14	122	221	1.2e-15	57.9
LXL04_032064	`PF13855.13`	LRR_8	155	215	1.3e-32	112.1
LXL04_032064	`PF23598.2`	LRR_14	200	303	1.2e-15	57.9
LXL04_032064	`PF12799.14`	LRR_4	204	237	9.3e-19	67.8
LXL04_032064	`PF13855.13`	LRR_8	225	285	1.3e-32	112.1
LXL04_032064	`PF13855.13`	LRR_8	250	309	1.3e-32	112.1
LXL04_032064	`PF13855.13`	LRR_8	298	358	1.3e-32	112.1
LXL04_032064	`PF13855.13`	LRR_8	323	382	1.3e-32	112.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SSD1`	Arabidopsis thaliana	Protein TOO MANY MOUTHS	63.556%	Swiss-Prot	strong database homology
`Q9SJH6`	Arabidopsis thaliana	Receptor like protein 29	36.364%	Swiss-Prot	moderate database homology
`Q5PP26`	Arabidopsis thaliana	Piriformospora indica-insensitive protein 2	31.750%	Swiss-Prot	moderate database homology
`Q9LP24`	Arabidopsis thaliana	Probable leucine-rich repeat receptor-like protein kinase At1g35710	38.603%	Swiss-Prot	moderate database homology
`O82318`	Arabidopsis thaliana	Leucine-rich repeat receptor-like serine/threonine-protein kinase SKM1	34.925%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card