LXL04_030245 | RubberDandelionOmics

Gene overview

LXL04_030245

Reference: OH-1004 Chr: Chr06 Coordinates: 112251157-112255267 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1323 bp · LXL04_030245|LXL04_030245|OH1004|cDNA

ATGGACCTGGATATGGTGATCCAAACTAGCTTTAGTTTCTGTTTCTTCAATCTTGTATTTCATGGATTCTCACACCTATTTGACTCAAAACAGATATCCATGAAGATTGCAATAGAAGGATGCATGCATGGGGATCTGGACAATGTCTATTCAACTCTCTTACATCTACAACAAGTGGAAAACACAAAAATTGATCTTCTCATCTGTTGCGGTGATTTCCAGGCAGTTAGAAACGAGAAGGATCTAGAAAGCCTAAGTGT...

CDS

Download CDS FASTA

1323 bp · LXL04_030245|LXL04_030245|OH1004|CDS

ATGGACCTGGATATGGTGATCCAAACTAGCTTTAGTTTCTGTTTCTTCAATCTTGTATTTCATGGATTCTCACACCTATTTGACTCAAAACAGATATCCATGAAGATTGCAATAGAAGGATGCATGCATGGGGATCTGGACAATGTCTATTCAACTCTCTTACATCTACAACAAGTGGAAAACACAAAAATTGATCTTCTCATCTGTTGCGGTGATTTCCAGGCAGTTAGAAACGAGAAGGATCTAGAAAGCCTAAGTGT...

Protein

Download Protein FASTA

440 aa · LXL04_030245|LXL04_030245|OH1004|PROTEIN

MDLDMVIQTSFSFCFFNLVFHGFSHLFDSKQISMKIAIEGCMHGDLDNVYSTLLHLQQVENTKIDLLICCGDFQAVRNEKDLESLSVPPKYRAMNSFWKYYSGEKIAPFPTIFIGGNHEASNYLWELYYGGWAAPNIYFLGFAGVVKFGGIRIGGLSGIYKYRDYRSGHYERPPYNNSDIKSVYHVREYDVHKLMQIEEPVDIFVSHDWPLGITDHGNWKNLVREKPYFEKEIEDRTLGSKAGAELLEKIKPPYWFSAHL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_030245`
TK1151 ID	TkA07G387810
OH-1004 ID	LXL04_030245
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 92.500 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_030245

Location Chr06:112251157-112255267 (+)

Description Similar to DBR1: Lariat debranching enzyme

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g31770`	Cleaves the 2'-5' phosphodiester linkage at the branch point of lariat intron pre-mRNAs after splicing and converts them into linear molecules that are subsequently degraded.	An Arabidopsis RNA lariat debranching enzyme is essential for embryogenesis.2004 · DOI: 10.1074/jbc.m309106200

Rice

Reference gene ID	Possible function	Papers / DOI
`Os03g0725300`	Cleaves the 2'-5' phosphodiester linkage at the branch point of lariat intron pre-mRNAs after splicing and converts them into linear molecules that are subsequently degraded.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_030245 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000375 RNA splicing, via transesterification reactions Biological Process

GO:0000398 mRNA splicing, via spliceosome Biological Process

GO:0009793 embryo development ending in seed dormancy Biological Process

GO:0005634 nucleus Cellular Component

GO:0008419 RNA lariat debranching enzyme activity Molecular Function

GO:0046872 metal ion binding Molecular Function

KEGG gene cross-reference

ath:AT4G31770

xla:380060

xla:444127

xtr:394544

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.781

Rank 1 · LXL04_030245 · OH-1004

Cytoplasm0.426

Rank 2 · LXL04_030245 · OH-1004

Mitochondrion0.034

Rank 3 · LXL04_030245 · OH-1004

Cell membrane0.029

Rank 4 · LXL04_030245 · OH-1004

Endoplasmic reticulum0.021

Rank 5 · LXL04_030245 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00149.34Metallophos34-262 aa

PF05011.19DBR1276-397 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_030245	`PF00149.34`	Metallophos	34	262	1e-12	49.7
LXL04_030245	`PF05011.19`	DBR1	276	397	1.7e-29	103.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q94K01`	Arabidopsis thaliana	Lariat debranching enzyme	72.316%	Swiss-Prot	strong database homology
`Q6AU07`	Oryza sativa subsp. japonica	Lariat debranching enzyme	64.000%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card