LXL04_029415 | RubberDandelionOmics

Gene overview

LXL04_029415

Reference: OH-1004 Chr: Chr06 Coordinates: 89776343-89778365 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

609 bp · LXL04_029415|LXL04_029415|OH1004|cDNA

ATGGATGATTTGTCTCACAACCTGCATGGTACAAGAGTCACAAAACTGGTGGATATGCCGGCTTGGGACTGCACTATTCCACCTCAGTTCGGATCATTGGTTTCCCTCCAAGAGTTTCGAATCGGCGGTAACCCGTATTTGACAGGAGAGATTCCACCGGAGTTGGGATTTCTGTCCAATCTCATCACTTTCGGAGTGGACTTTCTGGGATATCTGGGTCAATCCCACTGGAGCTTGGGTTGTGCTCGGACCTCGGAGCT...

CDS

Download CDS FASTA

609 bp · LXL04_029415|LXL04_029415|OH1004|CDS

ATGGATGATTTGTCTCACAACCTGCATGGTACAAGAGTCACAAAACTGGTGGATATGCCGGCTTGGGACTGCACTATTCCACCTCAGTTCGGATCATTGGTTTCCCTCCAAGAGTTTCGAATCGGCGGTAACCCGTATTTGACAGGAGAGATTCCACCGGAGTTGGGATTTCTGTCCAATCTCATCACTTTCGGAGTGGACTTTCTGGGATATCTGGGTCAATCCCACTGGAGCTTGGGTTGTGCTCGGACCTCGGAGCT...

Protein

Download Protein FASTA

202 aa · LXL04_029415|LXL04_029415|OH1004|PROTEIN

MDDLSHNLHGTRVTKLVDMPAWDCTIPPQFGSLVSLQEFRIGGNPYLTGEIPPELGFLSNLITFGVDFLGYLGQSHWSLGCARTSELRNLYLHMNKIKNSSPENPDSRDDGFSYPWTFIPFTKLGFSIDNILDCLKDENVIGKGCSGVVYKAEEMPNGEVIVVKKLWKTKKEEEPAIDSFAAEIQILSQHSASKYRHREGCR

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_029415`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_029415

Location Chr06:89776343-89778365 (+)

Description Similar to At1g34110: Probable LRR receptor-like serine/threonine-protein kinase At1g34110

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g34110`	Together with RGI1, RGI2, RGI3 and RGI4, acts as a receptor of RGF1, a peptide hormone that maintains the postembryonic root stem cell niche by regulating the expression levels and patterns of the transcription factor PLETHORA (PLT).	RGF1 INSENSITIVE 1 to 5, a group of LRR receptor-like kinases, are essential for the perception of root meristem growth factor 1 in Arabidopsis thaliana.2016 · DOI: 10.1038/cr.2016.63
`At3g24240`	Together with RGI2, RGI3, RGI4 and RGI5, acts as a receptor of RGF peptides (e.g. RGF1, GLV5/CLEL1/RGF2, GLV7/CLEL3/RGF3, GLV3/RGF4, GLV10/CLEL7/RGF5 and RGF10/CLELN), peptide hormones which maintain the postembryonic root stem cell niche by regulating the expression levels and patterns of the transcription factor PLETHORA (PLT, e.g. PLT1 and PLT2).	RGF1 INSENSITIVE 1 to 5, a group of LRR receptor-like kinases, are essential for the perception of root meristem growth factor 1 in Arabidopsis thaliana.2016 · DOI: 10.1038/cr.2016.63
`At5g48940`	Together with RGI1, RGI3, RGI4 and RGI5, acts as a receptor of RGF peptides (e.g. RGF1, GLV5/CLEL1/RGF2, GLV7/CLEL3/RGF3, GLV3/RGF4, GLV10/CLEL7/RGF5 and RGF10/CLELN), peptide hormones which maintain the postembryonic root stem cell niche by regulating the expression levels and patterns of the transcription factor PLETHORA (PLT, e.g. PLT1 and PLT2).	RGF1 INSENSITIVE 1 to 5, a group of LRR receptor-like kinases, are essential for the perception of root meristem growth factor 1 in Arabidopsis thaliana.2016 · DOI: 10.1038/cr.2016.63
`At4g28650`	Involved in the regulation of procambium maintenance and polarity during vascular-tissue development.	A receptor heteromer mediates the male perception of female attractants in plants.2016 · DOI: 10.1038/nature16975
`At5g61480`	Acts with CLE41p and CLE44p peptides as a ligand-receptor pair in a signal transduction pathway involved in the regulation of procambium maintenance and polarity during vascular-tissue development.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_029415 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006468 protein phosphorylation Biological Process

GO:0009755 hormone-mediated signaling pathway Biological Process

GO:0010067 procambium histogenesis Biological Process

GO:0010074 maintenance of meristem identity Biological Process

GO:0010078 maintenance of root meristem identity Biological Process

GO:0010082 regulation of root meristem growth Biological Process

GO:0010087 phloem or xylem histogenesis Biological Process

GO:0010183 pollen tube guidance Biological Process

GO:0010449 root meristem growth Biological Process

GO:0030154 cell differentiation Biological Process

GO:0046777 protein autophosphorylation Biological Process

GO:2000280 regulation of root development Biological Process

KEGG gene cross-reference

ath:AT1G34110

ath:AT3G24240

ath:AT4G28650

ath:AT5G48940

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.298

Rank 1 · LXL04_029415 · OH-1004

Cell membrane0.241

Rank 2 · LXL04_029415 · OH-1004

Nucleus0.234

Rank 3 · LXL04_029415 · OH-1004

Extracellular0.135

Rank 4 · LXL04_029415 · OH-1004

Endoplasmic reticulum0.122

Rank 5 · LXL04_029415 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`C0LGF5`	Arabidopsis thaliana	LRR receptor-like serine/threonine-protein kinase RGI5	64.130%	Swiss-Prot	weak database homology
`Q9LHP4`	Arabidopsis thaliana	LRR receptor-like serine/threonine-protein kinase RGI1	44.340%	Swiss-Prot	weak database homology
`C0LGV1`	Arabidopsis thaliana	LRR receptor-like serine/threonine-protein kinase RGI2	45.370%	Swiss-Prot	weak database homology
`Q9M0G7`	Arabidopsis thaliana	MDIS1-interacting receptor like kinase 1	38.889%	Swiss-Prot	weak database homology
`Q9FII5`	Arabidopsis thaliana	Leucine-rich repeat receptor-like protein kinase TDR	41.304%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card