LXL04_027978 | RubberDandelionOmics

Gene overview

LXL04_027978

Reference: OH-1004 Chr: Chr06 Coordinates: 28053637-28056872 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1725 bp · LXL04_027978|LXL04_027978|OH1004|cDNA

ATGGAAATAGGTGAAGGCGGGTTGGATTCAAATTTCCCTCCGAAACAAAATCAATCGGACGCGGCGGAGGTAACGACGGCATCACCGATGGATTTACCGGCTGCAAAACGGCAACTCGATTTCAACAGCGTTGGTGGTAGTGCACTGCCGCCGGCGCCGCCGGCGAGGGCTCAACAGATTTTGCCGGAGCACCCTCAACGGCCGGTTGTTGTACAGGCTCAATACCCAACGCCGCAGCCTCCACTACATCCAAAACACTC...

CDS

Download CDS FASTA

1725 bp · LXL04_027978|LXL04_027978|OH1004|CDS

ATGGAAATAGGTGAAGGCGGGTTGGATTCAAATTTCCCTCCGAAACAAAATCAATCGGACGCGGCGGAGGTAACGACGGCATCACCGATGGATTTACCGGCTGCAAAACGGCAACTCGATTTCAACAGCGTTGGTGGTAGTGCACTGCCGCCGGCGCCGCCGGCGAGGGCTCAACAGATTTTGCCGGAGCACCCTCAACGGCCGGTTGTTGTACAGGCTCAATACCCAACGCCGCAGCCTCCACTACATCCAAAACACTC...

Protein

Download Protein FASTA

574 aa · LXL04_027978|LXL04_027978|OH1004|PROTEIN

MEIGEGGLDSNFPPKQNQSDAAEVTTASPMDLPAAKRQLDFNSVGGSALPPAPPARAQQILPEHPQRPVVVQAQYPTPQPPLHPKHSPLQQQPLRPIKAESPKARPRQNVEGKDGTPKKQKQCNCKHSKCLKLYCECFASGTYCDGCNCVNCHNNVENEPARRDAVEATLERNPDAFRPKIASSPHGNRDKREEAGGKHNKGCNCKKSGCLKKYCECFQANILCSEMCRCMDCKNFDGSEERQALFHGDCGSHISHLQLA...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_027978`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_027978

Location Chr06:28053637-28056872 (+)

Description Similar to TCX5: Protein tesmin/TSO1-like CXC 5

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g29000`	Plays a role in development of both male and female reproductive tissues.	No verified direct reference in this release
`At2g20110`	Plays a role in development of both male and female reproductive tissues.	No verified direct reference in this release
`At5g25790`	Plays a role in development of both male and female reproductive tissues.	No verified direct reference in this release
`At3g16160`	Plays a role in development of both male and female reproductive tissues.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_027978 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000122 negative regulation of transcription by RNA polymerase II Biological Process

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0007283 spermatogenesis Biological Process

GO:0007307 eggshell chorion gene amplification Biological Process

GO:0045892 negative regulation of DNA-templated transcription Biological Process

GO:0045944 positive regulation of transcription by RNA polymerase II Biological Process

GO:0000785 chromatin Cellular Component

GO:0005634 nucleus Cellular Component

GO:0031523 Myb complex Cellular Component

GO:0070176 DRM complex Cellular Component

GO:0000987 cis-regulatory region sequence-specific DNA binding Molecular Function

KEGG gene cross-reference

ath:AT2G20110

ath:AT3G16160

ath:AT4G29000

ath:AT5G25790

dme:Dmel_CG6061

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.976

Rank 1 · LXL04_027978 · OH-1004

Cytoplasm0.083

Rank 2 · LXL04_027978 · OH-1004

Cell membrane0.023

Rank 3 · LXL04_027978 · OH-1004

Endoplasmic reticulum0.012

Rank 4 · LXL04_027978 · OH-1004

Plastid0.010

Rank 5 · LXL04_027978 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03638.22TCR120-155 aa

PF03638.22TCR201-235 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_027978	`PF03638.22`	TCR	120	155	3e-24	85.7
LXL04_027978	`PF03638.22`	TCR	201	235	3e-24	85.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SZD1`	Arabidopsis thaliana	Protein tesmin/TSO1-like CXC 5	53.016%	Swiss-Prot	strong database homology
`Q9SL70`	Arabidopsis thaliana	Protein tesmin/TSO1-like CXC 6	49.133%	Swiss-Prot	moderate database homology
`F4JY84`	Arabidopsis thaliana	Protein tesmin/TSO1-like CXC 7	42.227%	Swiss-Prot	moderate database homology
`Q700D0`	Arabidopsis thaliana	Protein tesmin/TSO1-like CXC 8	31.961%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card