LXL04_027959 | RubberDandelionOmics

Gene overview

LXL04_027959

Reference: OH-1004 Chr: Chr06 Coordinates: 27743659-27748817 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1752 bp · LXL04_027959|LXL04_027959|OH1004|cDNA

ATGCTAGTTCCACCGGAAACGGAACCGCAGCCGCTGGTTTTCCTCTCTCCGGCAGTTGGTTCGCCATCAGCCTCTCCTCTGCTCGTGTCCTTCTCCTTCCAGTCGCCATCATCTCCACCGGGTATAGCCGCCTTTTACAAACAACTCATCCGCGCAGTCTCGCAATTACCGAACACGCTCGACACATCTGCGATTCATCTCCGTCTGCTCGACATCTGCGACTCATCAGACATCTGCCCTCTCCGACGGTCTGAAGAAAA...

CDS

Download CDS FASTA

1752 bp · LXL04_027959|LXL04_027959|OH1004|CDS

ATGCTAGTTCCACCGGAAACGGAACCGCAGCCGCTGGTTTTCCTCTCTCCGGCAGTTGGTTCGCCATCAGCCTCTCCTCTGCTCGTGTCCTTCTCCTTCCAGTCGCCATCATCTCCACCGGGTATAGCCGCCTTTTACAAACAACTCATCCGCGCAGTCTCGCAATTACCGAACACGCTCGACACATCTGCGATTCATCTCCGTCTGCTCGACATCTGCGACTCATCAGACATCTGCCCTCTCCGACGGTCTGAAGAAAA...

Protein

Download Protein FASTA

583 aa · LXL04_027959|LXL04_027959|OH1004|PROTEIN

MLVPPETEPQPLVFLSPAVGSPSASPLLVSFSFQSPSSPPGIAAFYKQLIRAVSQLPNTLDTSAIHLRLLDICDSSDICPLRRSEEKEPIFPGRILSGRHSSTSHAMLAFGSMIGRKFSSATSHPLRVCVVGSGPAGFYTAEKMLKAHEGAEVDIIDRLPTPFGLVRSGVAPDHPETKIVINQFSRVAHNQRCSFFGNVSLGSSVSLSDLRQFYHVVVLAYGAESDRALGIPGEELKGIHSAREFVWWYNGHPDLSNMTL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_027959`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_027959

Location Chr06:27743659-27748817 (-)

Description Similar to MFDR: NADPH:adrenodoxin oxidoreductase, mitochondrial

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g32360`	Associates in vitro with the adrenodoxin-like protein MFDX1 to form an efficient low potential electron transfer chain that is able to reduce cytochrome C.	Identification and molecular characterization of mitochondrial ferredoxins and ferredoxin reductase from Arabidopsis.2003 · DOI: 10.1023/a:1025015811141

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_027959 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006091 generation of precursor metabolites and energy Biological Process

GO:0006124 ferredoxin metabolic process Biological Process

GO:0006694 steroid biosynthetic process Biological Process

GO:0006744 ubiquinone biosynthetic process Biological Process

GO:0008203 cholesterol metabolic process Biological Process

GO:0009102 biotin biosynthetic process Biological Process

GO:0022900 electron transport chain Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0005743 mitochondrial inner membrane Cellular Component

GO:0005759 mitochondrial matrix Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0004324 ferredoxin-NADP+ reductase activity Molecular Function

KEGG gene cross-reference

ath:AT4G32360

bta:282604

hsa:2232

rno:79122

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.475

Rank 1 · LXL04_027959 · OH-1004

Cytoplasm0.296

Rank 2 · LXL04_027959 · OH-1004

Plastid0.162

Rank 3 · LXL04_027959 · OH-1004

Nucleus0.160

Rank 4 · LXL04_027959 · OH-1004

Peroxisome0.085

Rank 5 · LXL04_027959 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07992.21Pyr_redox_2127-312 aa

PF13450.13NAD_binding_8130-174 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_027959	`PF07992.21`	Pyr_redox_2	127	312	1.1e-09	38.8
LXL04_027959	`PF13450.13`	NAD_binding_8	130	174	7.2e-06	26.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8W3L1`	Arabidopsis thaliana	NADPH:adrenodoxin oxidoreductase, mitochondrial	69.639%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card